KEGG   Schistosoma mansoni: Smp_121380Help
Entry
Smp_121380        CDS       T01095                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
smm  Schistosoma mansoni
Brite
Exosome [BR:smm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Smp_121380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 122 aa AA seqDB search
MPPKVVSGKAAKKASKVKLPKVDKKKKRRRKESYAIYIYKVLRQVHPDTGISSKAMSIMN
SFVNDIFERIAAEASRLSHYNKKSTISSREVQTAVRLLLPGELAKHAVSEGTKAVTKYSG
SK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctaaagttgtgtctggtaaagctgccaagaaggcctcgaaggttaagctgccg
aaggttgataagaagaagaagaggaggaggaaggagagttatgctatctacatctacaaa
gtccttcgtcaagtccatcctgacactggtatctcgtcgaaggcgatgtcgatcatgaac
tcgtttgtgaacgatatctttgagcgcattgccgcagaggccagccgactgtcacactac
aacaagaagtcgacaatttcaagccgagaggtgcagacagcggttcggttgttgttgcca
ggtgaattggcgaaacacgcggtatctgaaggcacgaaggcagtgacgaagtacagtggg
tctaagtaa

DBGET integrated database retrieval system