KEGG   Schistosoma mansoni: Smp_122910Help
Entry
Smp_122910        CDS       T01095                                 

Definition
(RefSeq) ataxia telangiectasia mutated (atm)-related
  KO
K07203  
serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
smm  Schistosoma mansoni
Pathway
Autophagy - other
Autophagy - animal
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:smm00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Smp_122910
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Smp_122910
   04136 Autophagy - other eukaryotes
    Smp_122910
Enzymes [BR:smm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Smp_122910
Protein kinases [BR:smm01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   Smp_122910
Membrane trafficking [BR:smm04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    Smp_122910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
GeneDB: 
UniProt: 
Position
2
AA seq 2598 aa AA seqDB search
MNTNPNSLISQFVQGIKSRSEDDRFKTVAELCKVVSSELKEVSNQNYVICLDLLCNELIN
IVSNGDVHEKKGAIVAMGCLAEVDFMSVHNHCQRFVKQLLTQSVTTDLQLTALEARLIGQ
LGLVFPYDFIEEQTKNACSILSKDISDAQKHFAILTLREFILHTPTSFCQHMGSFITAIL
SALRDKNSITRELAGVALRCAFILTAKREQRRYRTYLSVDHSRMGEGPGSFSNLEGGASS
VSNRISRKLNRDDWIHGNILILQELLFCVQPQFSKLLMELDQMCGLVRNKSLEVLGLRDG
IKQESNGYQQHHEQQQYGRQNFSNLSSEICLCLLLENIDKIWASVLMWINSRNHQIMFLL
YKLIPRLVALKPSEFQDTERQRTVMEWMLQCLRKEKEKPMILLNLSLICYFMGPEFATSN
YLTQIFQSIRSYLPTQKDVSNKKRSPALETSAILSVSLFTKSLGPAINESVNQILDAMVA
SGLNQPLIASFKVIAMHIPRLRKEIQDCLLNNISLVLMNNSGGLNATGTEFAHVAIPGGF
SASGELSTDVAVVALALKTLGSFNFDGHTLAHFVRHICDNFISISTCEVKEIRLEAVKTC
AHLMIPWLKSTETQQWYARPALNTVADVLNKLLTVGISDPDPDVRRCVFLSFDQRFDLHL
AQSDHLNYLFLALYDEVFDIRCLVMQRLGRLSDINPACVQPNLRKVLLHTLNDLSHSGST
RNKEQSALLLACLIATAPRFLIPYSEPLIHILLPRIRQALPASLRASLIVTSFSRLQNST
FTNNKAPRSIYHYMDEFIPILAYMMQDTSCFLKRSIAVWTLTRLVSHTGYVVIPYKRYPQ
LLNILLGMLKREEIKCIRQEVLRALGVLGALDPFKFKLYSGQVDTYGDTGIAVSHHEVVE
RKDVDITQSELVINLSWESRDVFFSVCALSALIHSLRDPALHSQYGSIVHTIVYVLKLLG
PRSVIYLRQLIPDYFRCLENTRDARLQEFLIRQLGNVMTIVQLNTKEFAHEVIDLLITHW
WIAPNVQRACIGLLSPMSSVLGAEFRTYLTRLIPTILRMFHHESNESNLIAVSLLEVLPE
FGYTLKDYAHIIVPAISSLIDITSEAMGSVHLRKACLECLARFTDCVDLDDFAGQIIHPI
CPCLNAINELRVPAMDVLTGLLYRMGQKFKFFLPLVQKMLSRLQLHTPRFNTVLGQVEKG
AYLPTTSDRAHVKFTSISTRNRAQKLNVDDSETPGTVKLLKINNTNLERAWHSSRMVSHD
DWSQWLKTLNMALLRESPSPAIRACSQLTAITPGIGRTLFNAAFLSCWPELNYHQQDDLI
NTLERVLRVPDQSPEVSQTILNLEEFMAHMDKYSSSSHRVHLPLPLGVLADRALKNRAYA
KALYYKEQEFLMESEKRSCPSPATLSSLLTMYSKLNLEEAANGVLLYATRSTQDKLANEE
VWREKLHDWKSALNLYERKLEDDRIKDKSSLILGRMRCLRALGQWSVVLQCTTGSKCAIT
FYFRQLVDIINSETLSISLRHEYIKFYFIKVNCPREIEGPGFKFIVSSRGCILMRSPTPE
FSARSLIPGFQWCVGTTWQSRLLGCNSVIEDWSQIIQLRSLVLEPYEDRRSWLRFAGLCR
RSGRFILSRQVLENLLGLDPAGIPPCDPIPSSDPAIVFGYTKLLWAVGAHEEAVSRLCVL
KTHVHGERSNITCLHYFHLIIFKLSFIARCCLKLGSWYSELYTRSPPGGHQIDNHSLAYT
PNSVFTAASGNGLQFSVAAAARTLSKVNSNSDVIDNIHPSQMSRGAGMRLSNNYSGIVRC
MELHAAPSVKGFDSLRLINLLFKFGHLTEIREVIREGLTKIRLDNWLLVIQQLLARIDTP
REYVATIIIDLLISVGQRYPQSMVYPLVLAFKSGGSDRRRYNANRILYSMEEQNSRLISE
AFLLNEELIRLSITWVEMWSEALEDASRVYFGEKDIAKMFRLLHPLHQMMDRGHETIHEA
TFLQENGNDLAESRLCCERYELTQVRIDLQKAWEGYYTLYRRFAKQVNNMTTLELTVSSP
RLHEYGQDWQLAVPGSYEPHRPLVRIASIKNCLTFITSKQRPRKLTITGSNGHQYVFLLK
GHEDTRQDERIMQFFGLVNTLLINNPETLRRNLTIQRMSVIPLSTYTGLIGWVPNSDTFH
NLIRDYREKADVVLNKENREMLRLAPDFDRLNVIQKTEIFEAGLRESSGRDLANILWLKS
HSSEAWFERRTNFTRSMATMSMVGYILGLGDRHPSNIMLSRVTGKVVHIDFGDCFEVATM
REKFPEKVPFRLTRMIISAMEVTGIDGVYRHTCEMVMSLLRSNRESLLAVLEAFIHDPLL
QWVLHENRKEFNHLENKLDDGGGGGGGIAPAIGTNCLANGTGGGVHGVTTANNQSVQLKP
GARNSDYPHRQVYAHQQHHAVQNTLRRPTDKSNNLTSGQQNSQGHFQQQNLNRRANSPNR
VFTNPNHPDSASLRDPQKVNQWRHHLCNGPWFGCYETAKRLRKQMESGHIVVERHGLQGF
IFSAKPPSTEDSCIDSESQPVTLGNVRARSVMERIRQKLTGTERDQVMSVSAQVDFLIRE
ATSNQNLCQMYIGWCAFW
NT seq 7797 nt NT seq  +upstreamnt  +downstreamnt
atgaatactaacccgaattctcttatcagtcagtttgtgcaagggattaaatctcgtagt
gaggatgacaggtttaaaactgtggccgaattatgcaaagtagtaagcagtgaactgaaa
gaggtatcaaaccaaaactacgttatatgtttggatttgttatgtaatgagttaattaac
atagtttctaatggtgatgtacatgaaaaaaaaggggctatagtcgcaatgggttgttta
gctgaggtggattttatgagtgttcacaatcattgtcaacgttttgtaaaacagttgctc
actcagtcagtaactacagatcttcagctaacagctttagaagcgaggctcattgggcaa
ttgggtttagtatttccatatgattttattgaagagcaaaccaagaatgcttgtagtata
ctatcgaaagatatttctgatgcgcaaaaacacttcgcaatcctaactttacgtgaattt
attttgcatacaccaacaagcttctgtcaacatatgggttcatttattacagccattctt
tctgctcttcgagataagaactcgattacaagggagttggctggagttgcgttgcgttgt
gcattcattttaactgctaaacgtgaacagagacgctacagaacatatttaagtgtggac
catagtcgtatgggtgaaggacctggaagtttttcaaatcttgaaggtggtgcatcatct
gtttccaatcgaatttctagaaaacttaaccgagatgattggatacatgggaatatatta
atacttcaggagttacttttctgtgttcaaccacagttttccaaattgctaatggagttg
gaccagatgtgtgggttggtaagaaataaatcacttgaagtacttggtttacgagatggt
ataaaacaggaatctaacggctatcaacagcatcatgaacaacaacaatatggacgacag
aatttcagtaatttatcttctgagatctgtctatgtcttctactggagaatattgacaaa
atatgggcttcagtattgatgtggattaatagtcgcaatcatcagataatgtttttacta
tacaaactgattcctcgtcttgttgctttaaaacctagtgaatttcaagataccgaacgt
cagcgtactgtaatggaatggatgcttcaatgtttgcgtaaggaaaaagagaaacccatg
attttgttaaatttatctttaatttgttattttatgggtcctgaattcgctacatcaaat
tatctcactcaaattttccaatcaattcgttcttatctaccaacacaaaaggatgtttcg
aataagaagcgttcacctgccttggaaacatctgctattttatctgtcagtctttttaca
aaatctctcggtcctgcaattaacgaatcagtaaaccagatactagatgcaatggtagca
tctggcttgaatcaacctttaattgcttcttttaaagtgattgctatgcatatccctcga
ttacgtaaagaaattcaggattgtctgctaaacaacatcagtttagttctaatgaataat
agtggaggattaaatgctactgggactgaatttgctcatgtagctattcctggaggattt
tcagcttctggagaattatctacagatgtagcagttgtggctttggcattgaaaactcta
gggagtttcaactttgatggtcatactttggcacattttgttcgacatatttgtgacaat
tttatatctattagtacatgcgaagtaaaagaaatccgtttggaagcggttaaaacttgt
gctcatctaatgattccttggctcaagtccactgaaacacaacaatggtatgctcgacca
gctttaaatacggttgctgatgttttgaataagttgctgactgtaggaataagtgatcca
gatcctgatgttcggcgttgtgtattcctatcctttgatcaacgttttgatcttcattta
gctcagtcagatcacttaaattatcttttcttggctttgtacgatgaagtttttgatatt
cgctgtttagtaatgcaacgtctaggtcgtctatcggatattaatcctgcatgtgtccaa
cctaatctacgaaaagttttgttacatactttaaatgatctatctcatagtggttcaact
agaaacaaagaacaatcagctttattattagcgtgtttaattgctacagcacctagattt
cttattccttattctgaaccattaattcatattttattaccacgtattcgacaagcttta
ccagcatcattacgtgctagtttaatagtgactagtttttctagacttcaaaattccact
tttacaaataataaagcgccacgctctatttatcattatatggatgaatttatacctatt
ctagcctatatgatgcaagatacatcgtgttttttaaagcgatcaattgctgtttggact
ctaactagactggtttctcacactggttatgttgttattccgtataaacgttatcctcag
ttgttgaatattctgttaggtatgctaaaacgtgaagaaatcaaatgtatccgtcaagag
gtattgagagctcttggtgttcttggtgcacttgatcccttcaagttcaaattatattcc
ggtcaagttgatacatacggtgatacaggaattgctgtgagtcatcatgaagtagttgaa
cgtaaagatgttgatataacccaatcagaacttgttatcaatttgtcttgggaaagtcgt
gatgttttcttctcagtttgtgctctatctgcactgattcattcactacgagatcctgca
cttcacagccaatatggtagcattgtacatacgatagtttatgttttaaaactattgggt
ccacgctcagtgatttatctacgtcagcttataccggattattttcgatgtttagaaaat
acacgtgatgctagattgcaagagtttcttattcgtcaattgggtaatgtaatgactatc
gtgcaattgaatacaaaagaatttgctcatgaagtaattgatttattaattacacattgg
tggattgctccaaatgttcaacgtgcatgtattggtttattaagtccaatgtcatctgta
ttaggcgctgaatttcgtacatatttaacacgtcttataccaaccatattgagaatgttt
catcatgaatcaaatgaatcaaatttaattgctgtaagtcttttagaagttcttccagaa
tttggatacacacttaaggattatgctcatattattgttcctgcaatatcaagtttaata
gatattaccagcgaagcaatgggtagtgtacatcttcgtaaagcgtgtttagaatgttta
gcacgatttacagattgtgttgatttagatgattttgctggacaaataattcatccaata
tgcccatgtttgaatgcaattaatgaacttcgtgtaccggctatggatgtattaactgga
ttgttgtatcgtatgggtcaaaaattcaaatttttcctgcctttagtacaaaagatgcta
agtcgtttgcagttacacacacctcgatttaatactgtgcttggacaagttgaaaaaggt
gcctatctaccgacaactagtgatcgtgcacacgttaaatttactagcatttctacacgt
aatcgtgcacaaaaattgaatgttgatgattcagaaacacctgggactgttaaacttttg
aaaattaacaatactaatttagaacgtgcttggcattcttctcgtatggttagtcatgat
gattggagtcaatggttgaaaacattgaatatggcacttttacgtgaatcaccaagtcct
gctattcgtgcatgtagtcagttgacagctattacacctgggataggtcgtacattgttc
aatgctgcatttcttagttgctggcctgaattaaactatcatcaacaagatgatttgatc
aatactttagaacgtgtactacgtgtaccagaccagtcaccagaagttagtcaaactata
ttaaatcttgaagagttcatggctcatatggacaaatattcaagttcatcacatcgggtt
cacttaccattacctttgggtgttttagctgatcgagcattaaaaaatcgcgcttatgct
aaagcattatattataaagaacaagaatttctcatggaatctgaaaaacgttcttgtcct
agtccggcaactttatcatctttacttaccatgtatagtaaattgaatttagaggaagca
gccaatggagtattgttgtatgcaacacgtagcactcaagataaactagctaatgaagaa
gtttggagagaaaaattacatgactggaaatctgctttaaatttatatgaacgtaaatta
gaagatgatcgaataaaagacaaaagttctcttattcttggtcgaatgcgatgtcttcga
gctttaggtcaatggtcagttgtattgcagtgtactacaggttcaaaatgtgccataaca
ttttactttcgacagctagttgatatcatcaactctgaaaccctatcaatatcacttaga
catgaatacatcaagttttattttattaaggttaactgtcctcgcgagatcgagggtcct
ggattcaagttcatcgtatcgagtcgtggctgcatactaatgaggagtcccacaccagaa
tttagcgcccgttcacttattccggggttccagtggtgtgtaggaaccacatggcaatct
cgcttacttggctgtaattctgtaatagaagattggagtcaaatcatccaactacgtagt
ttagtcttggaaccatatgaagatcgtagatcttggttacgctttgctggactgtgtcgt
cgaagtggtcgttttattttatcacgtcaagtattagaaaatctgttgggtttagatcca
gctggtattccaccatgtgatcctattccaagttctgatccagcaattgtatttggatat
actaaactactatgggcagttggagcgcatgaggaagcggttagtcgtttatgtgtttta
aaaacacatgtacacggtgagcgatctaacattacttgtcttcattattttcatctaatt
atttttaaactttcttttattgctagatgttgtttgaaattaggatcatggtattcagaa
ttgtatacacgttcaccacctggcggtcatcaaatagacaatcattcattagcttataca
cctaattcagtctttacagctgccagtggaaatggactacagttttccgtagctgctgca
gcacgtactttatcaaaagtgaattctaatagtgatgtgatagataatatacatccatct
caaatgtcacgtggagctggaatgcgtttatcaaataattatagtggaatagtaagatgt
atggaattacatgctgctccatctgttaagggtttcgatagtttacgtttaatcaattta
ttatttaaatttggtcatttaactgaaattcgtgaagtgatacgtgaaggtttaactaaa
atacgtttggataattggttacttgttatacaacaattattagctcgtattgatacacct
agagaatatgttgctactatcataattgatttgttaatatctgttggacaacgttatcca
cagtctatggtttatccattagtattagcatttaaatctggtggctctgatcgtcggcgt
tataacgctaatcgtattctgtacagtatggaagaacaaaattcacgtttgatatcagaa
gcatttttactaaatgaagaattaattcgtctatcgataacatgggttgaaatgtggtca
gaagcattggaagatgcaagtcgtgtttatttcggtgagaaagatattgcgaaaatgttt
cgattattacatccattacatcaaatgatggatcgtggtcatgaaacaattcatgaagca
acatttctacaagagaatggtaatgatcttgctgaatctcgattatgctgcgaaagatat
gagttaacgcaagttagaattgacttacagaaagcatgggaaggttattatactttgtat
agacgttttgccaagcaagtaaacaacatgacaactttagaacttacagtgtcctcacct
cgtttgcatgaatatggacaagattggcagttagcagtacctggaagttatgagcctcac
cgaccacttgtaagaatagcatcaattaagaattgtttaacttttatcacctccaaacaa
cgtccacgtaaattaacgatcacaggttcaaatggtcaccaatacgtgtttttgttaaaa
ggacatgaagatactcgtcaagatgaacgtattatgcaatttttcggacttgtaaacaca
ttgttaatcaataatccggaaacgttacgtcgtaatttaacaattcaacggatgtctgtt
attccattatctacatacactggattgattggttgggttccaaacagtgacacattccat
aatttaatacgtgattatcgggaaaaagctgatgttgtgctaaacaaagagaatcgtgag
atgcttcgtttggcaccagatttcgatcgtctaaatgttatacaaaaaactgaaatattt
gaagctgggttaagagagtcatctgggagagatctagctaatattttatggttaaaaagt
cacagttctgaagcatggtttgagcgtagaacgaattttacacgatctatggctaccatg
tctatggttggttatattttggggttaggagataggcatccatcgaatataatgttgtct
cgagtgacaggcaaagtggtgcatattgattttggtgattgttttgaagtggctacaatg
agagaaaaattcccagagaaagtaccatttcggttaacacgtatgattatttctgctatg
gaggtgacaggaatagatggtgtttatcgccatacctgtgaaatggttatgtctctttta
cgttccaatcgtgaaagtcttcttgcagttttagaagcatttattcatgatccattgtta
cagtgggtactccatgaaaaccgtaaagaatttaatcacttagagaataagctagacgac
ggaggtggtggcggcggcggtatagctccagcaattggaacaaactgtttggcaaatggt
actggtggcggtgttcatggtgtaacaactgctaataatcagtcagtacagttgaaacct
ggtgcacgcaattcagattatccacatagacaagtgtatgctcatcaacagcatcatgct
gttcaaaatacacttcgacgtccaacagacaaaagtaataatttaacctcaggtcaacag
aattcacaaggacattttcaacagcaaaatttgaatagaagagctaattcgccgaacagg
gtgtttacaaatccaaatcatccagacagtgcttcattgcgtgatccacaaaaggtgaat
caatggcgtcatcatttgtgtaatggaccttggtttggttgttatgaaactgctaaacgt
ttaagaaagcaaatggaatccggtcacatagtagttgaacgtcatggactacaagggttc
atattttctgcaaaacctccaagcactgaagactcatgtattgattcagaatcccagcct
gttaccttaggaaatgtacgtgcacgttctgtaatggaaagaattaggcaaaaattgact
ggcactgagagagatcaagtgatgagcgtttcggctcaagtagacttccttatacgtgaa
gcaacttcaaatcaaaatttatgccagatgtatataggctggtgtgctttctggtga

DBGET integrated database retrieval system