KEGG   Schistosoma mansoni: Smp_122910Help
Entry
Smp_122910        CDS       T01095                                 

Definition
ataxia telangiectasia mutated (atm)-related
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
smm  Schistosoma mansoni
Pathway
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:smm04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 2611 aa AA seqDB search
MNTNPNSLISQFVQGIKSRSEDDRFKTVAELCKVVSSELKEVSNQNYVICLDLLCNELIN
IVSNGDVHEKKGAIVAMGCLAEVDFMSVHNHCQRFVKQLLTQSVTTDLQLTALEARLIGQ
LGLVFPYDFIEEQTKNACSILSKDISDAQKHFAILTLREFILHTPTSFCQHMGSFITAIL
SALRDKNSITRELAGVALRCAFILTAKREQRRYRTYLSVDHSRMGEGPGSFSNLEGGASS
VSNRISRKLNRDDWIHGNILILQELLFCVQPQFSKLLMELDQMCGLVRNKSLEVLGLRDG
IKQESNGYQQHHEQQQYGRQNFSNLSSEICLCLLLENIDKIWASVLMWINSRNHQIMFLL
YKLIPRLVALKPSEFQDTERQRTVMEWMLQCLRKEKEKPMILLNLSLICYFMGPEFATSN
YLTQIFQSIRSYLPTQKDVSNKKRSPALETSAILSVSLFTKSLGPAINESVNQILDAMVA
SGLNQPLIASFKVIAMHIPRLRKEIQDCLLNNISLVLMNNSGGLNATGTEFAHVAIPGGF
SASGELSTDVAVVALALKTLGSFNFDGHTLAHFVRHICDNFISISTCEVKEIRLEAVKTC
AHLMIPWLKSTETQQWYARPALNTVADVLNKLLTVGISDPDPDVRRCVFLSFDQRFDLHL
AQSDHLNYLFLALYDEVFDIRCLVMQRLGRLSDINPACVQPNLRKVLLHTLNDLSHSGST
RNKEQSALLLACLIATAPRFLIPYSEPLIHILLPRIRQALPASLRASLIVTSFSRLQNST
FTNNKAPRSIYHYMDEFIPILAYMMQDTSCFLKRSIAVWTLTRLVSHTGYVVIPYKRYPQ
LLNILLGMLKREEIKCIRQEVLRALGVLGALDPFKFKLYSGQVDTYGDTGIAVSHHEVVE
RKDVDITQSELVINLSWESRDVFFSVCALSALIHSLRDPALHSQYGSIVHTIVYVLKLLG
PRSVIYLRQLIPDYFRCLENTRDARLQEFLIRQLGNVMTIVQLNTKEFAHEVIDLLITHW
WIAPNVQRACIGLLSPMSSVLGAEFRTYLTRLIPTILRMFHHESNESNLIAVSLLEVLPE
FGYTLKDYAHIIVPAISSLIDITSEAMGSVHLRKACLECLARFTDCVDLDDFAGQIIHPI
CPCLNAINELRVPAMDVLTGLLYRMGQKFKFFLPLVQKMLSRLQLHTPRFNTVLGQVEKG
AYLPTTSDRAHVKFTSISTRNRAQKLNVDDSETPGTVKLLKINNTNLERAWHSSRMVSHD
DWSQWLKTLNMALLRESPSPAIRACSQLTAITPGIGRTLFNAAFLSCWPELNYHQQDDLI
NTLERVLRVPDQSPEVSQTILNLEEFMAHMDKYSSSSHRVHLPLPLGVLADRALKNRAYA
KALYYKEQEFLMESEKRSCPSPATLSSLLTIYSKLNLEEAANGVLLYATRSTQDKLANEE
VWREKLHDWKSALNLYERKLEDDRIKDKSSLILGRMRCLRALGQWSVVLQCTTGSKCAIT
FYFRQLVDIINSETLSISLRHEYIKFYFIKVNCPREIEGPGFKFIVSSRGCILMRSPTPE
FSARSLIPGFQWCVGTTWQSRLLGCNSVIEDWSQIIQLRSLVLEPYEDRRSWLRFAGLCR
RSGRFILSRQVLENLLGLDPAGIPPCDPIPSSDPAIVFGYTKLLWAVGAHEEAVSRLCVL
KTHVHGERSNITCLHYFHLIIFKLSFIARCCLKLGSWYSELYTRSPPGGHQIDNHSLAYT
PNSVFTAASGNGLQFSVAAAARTLSKVNSNSDVIDNIHPSQMSRGAGMRLSNNYSGIVRC
MELHAAPSVKGFVNSISLSPTANLQDSLRLINLLFKFGHLTEIREVIREGLTKIRLDNWL
LVIQQLLARIDTPREYVATIIIDLLISVGQRYPQSMVYPLVLAFKSGGSDRRRYNANRIL
YSMEEQNSRLISEAFLLNEELIRLSITWVEMWSEALEDASRVYFGEKDIAKMFRLLHPLH
QMMDRGHETIHEATFLQENGNDLAESRLCCERYELTQVRIDLQKAWEGYYTLYRRFAKQV
NNMTTLELTVSSPRLHEYGQDWQLAVPGSYEPHRPLVRIASIKNCLTFITSKQRPRKLTI
TGSNGHQYVFLLKGHEDTRQDERIMQFFGLVNTLLINNPETLRRNLTIQRMSVIPLSTYT
GLIGWVPNSDTFHNLIRDYREKADVVLNKENREMLRLAPDFDRLNVIQKTEIFEAGLRES
SGRDLANILWLKSHSSEAWFERRTNFTRSMATMSMVGYILGLGDRHPSNIMLSRVTGKVV
HIDFGDCFEVATMREKFPEKVPFRLTRMIISAMEVTGIDGVYRHTCEMVMSLLRSNRESL
LAVLEAFIHDPLLQWVLHENRKEFNHLENKLDDGGGGGGGIAPAIGTNCLANGTGGGVHG
VTTANNQSVQLKPGARNSDYPHRQVYAHQQHHAVQNTLRRPTDKSNNLTSGQQNSQGHFQ
QQNLNRRANSPNRVFTNPNHPDSASLRDPQKVNQWRHHLCNGPWFGCYETAKRLRKQMES
GHIVVERHGLQGFIFSAKPPSTEDSCIDSESQPVTLGNVRARSVMERIRQKLTGTERDQV
MSVSAQVDFLIREATSNQNLCQMYIGWCAFW
NT seq 7836 nt NT seq  +upstreamnt  +downstreamnt
atgaatactaacccgaattctcttatcagtcagtttgtgcaagggattaaatctcgtagt
gaggatgacaggtttaaaactgtggccgaattatgcaaagtagtaagcagtgaactgaaa
gaggtatcaaaccaaaactacgttatatgtttggatttgttatgtaatgagttaattaac
atagtttctaatggtgatgtacatgaaaaaaaaggggctatagtcgcaatgggttgttta
gctgaggtggattttatgagtgttcacaatcattgtcaacgttttgtaaaacagttgctc
actcagtcagtaactacagatcttcagctaacagctttagaagcgaggctcattgggcaa
ttgggtttagtatttccatatgattttattgaagagcaaaccaagaatgcttgtagtata
ctatcgaaagatatttctgatgcgcaaaaacacttcgcaatcctaactttacgtgaattt
attttgcatacaccaacaagcttctgtcaacatatgggttcatttattacagccattctt
tctgctcttcgagataagaactcgattacaagggagttggctggagttgcgttgcgttgt
gcattcattttaactgctaaacgtgaacagagacgctacagaacatatttaagtgtggac
catagtcgtatgggtgaaggacctggaagtttttcaaatcttgaaggtggtgcatcatct
gtttccaatcgaatttctagaaaacttaaccgagatgattggatacatgggaatatatta
atacttcaggagttacttttctgtgttcaaccacagttttccaaattgctaatggagttg
gaccagatgtgtgggttggtaagaaataaatcacttgaagtacttggtttacgagatggt
ataaaacaggaatctaacggctatcaacagcatcatgaacaacaacaatatggacgacag
aatttcagtaatttatcttctgagatctgtctatgtcttctactggagaatattgacaaa
atatgggcttcagtattgatgtggattaatagtcgcaatcatcagataatgtttttacta
tacaaactgattcctcgtcttgttgctttaaaacctagtgaatttcaagataccgaacgt
cagcgtactgtaatggaatggatgcttcaatgtttgcgtaaggaaaaagagaaacccatg
attttgttaaatttatctttaatttgttattttatgggtcctgaattcgctacatcaaat
tatctcactcaaattttccaatcaattcgttcttatctaccaacacaaaaggatgtttcg
aataagaagcgttcacctgccttggaaacatctgctattttatctgtcagtctttttaca
aaatctctcggtcctgcaattaacgaatcagtaaaccagatactagatgcaatggtagca
tctggcttgaatcaacctttaattgcttcttttaaagtgattgctatgcatatccctcga
ttacgtaaagaaattcaggattgtctgctaaacaacatcagtttagttctaatgaataat
agtggaggattaaatgctactgggactgaatttgctcatgtagctattcctggaggattt
tcagcttctggagaattatctacagatgtagcagttgtggctttggcattgaaaactcta
gggagtttcaactttgatggtcatactttggcacattttgttcgacatatttgtgacaat
tttatatctattagtacatgcgaagtaaaagaaatccgtttggaagcggttaaaacttgt
gctcatctaatgattccttggctcaagtccactgaaacacaacaatggtatgctcgacca
gctttaaatacggttgctgatgttttgaataagttgctgactgtaggaataagtgatcca
gatcctgatgttcggcgttgtgtattcctatcctttgatcaacgttttgatcttcattta
gctcagtcagatcacttaaattatcttttcttggctttgtacgatgaagtttttgatatt
cgctgtttagtaatgcaacgtctaggtcgtctatcggatattaatcctgcatgtgtccaa
cctaatctacgaaaagttttgttacatactttaaatgatctatctcatagtggttcaact
agaaacaaagaacaatcagctttattattagcgtgtttaattgctacagcacctagattt
cttattccttattctgaaccattaattcatattttattaccacgtattcgacaagcttta
ccagcatcattacgtgctagtttaatagtgactagtttttctagacttcaaaattccact
tttacaaataataaagcgccacgctctatttatcattatatggatgaatttatacctatt
ctagcctatatgatgcaagatacatcgtgttttttaaagcgatcaattgctgtttggact
ctaactagactggtttctcacactggttatgttgttattccgtataaacgttatcctcag
ttgttgaatattctgttaggtatgctaaaacgtgaagaaatcaaatgtatccgtcaagag
gtattgagagctcttggtgttcttggtgcacttgatcccttcaagttcaaattatattcc
ggtcaagttgatacatacggtgatacaggaattgctgtgagtcatcatgaagtagttgaa
cgtaaagatgttgatataacccaatcagaacttgttatcaatttgtcttgggaaagtcgt
gatgttttcttctcagtttgtgctctatctgcactgattcattcactacgagatcctgca
cttcacagccaatatggtagcattgtacatacgatagtttatgttttaaaactattgggt
ccacgctcagtgatttatctacgtcagcttataccggattattttcgatgtttagaaaat
acacgtgatgctagattgcaagagtttcttattcgtcaattgggtaatgtaatgactatc
gtgcaattgaatacaaaagaatttgctcatgaagtaattgatttattaattacacattgg
tggattgctccaaatgttcaacgtgcatgtattggtttattaagtccaatgtcatctgta
ttaggcgctgaatttcgtacatatttaacacgtcttataccaaccatattgagaatgttt
catcatgaatcaaatgaatcaaatttaattgctgtaagtcttttagaagttcttccagaa
tttggatacacacttaaggattatgctcatattattgttcctgcaatatcaagtttaata
gatattaccagcgaagcaatgggtagtgtacatcttcgtaaagcgtgtttagaatgttta
gcacgatttacagattgtgttgatttagatgattttgctggacaaataattcatccaata
tgcccatgtttgaatgcaattaatgaacttcgtgtaccggctatggatgtattaactgga
ttgttgtatcgtatgggtcaaaaattcaaatttttcctgcctttagtacaaaagatgcta
agtcgtttgcagttacacacacctcgatttaatactgtgcttggacaagttgaaaaaggt
gcctatctaccgacaactagtgatcgtgcacacgttaaatttactagcatttctacacgt
aatcgtgcacaaaaattgaatgttgatgattcagaaacacctgggactgttaaacttttg
aaaattaacaatactaatttagaacgtgcttggcattcttctcgtatggttagtcatgat
gattggagtcaatggttgaaaacattgaatatggcacttttacgtgaatcaccaagtcct
gctattcgtgcatgtagtcagttgacagctattacacctgggataggtcgtacattgttc
aatgctgcatttcttagttgctggcctgaattaaactatcatcaacaagatgatttgatc
aatactttagaacgtgtactacgtgtaccagaccagtcaccagaagttagtcaaactata
ttaaatcttgaagagttcatggctcatatggacaaatattcaagttcatcacatcgggtt
cacttaccattacctttgggtgttttagctgatcgagcattaaaaaatcgcgcttatgct
aaagcattatattataaagaacaagaatttctcatggaatctgaaaaacgttcttgtcct
agtccggcaactttatcatctttacttaccatatatagtaaattgaatttagaggaagca
gccaatggagtattgttgtatgcaacacgtagcactcaagataaactagctaatgaagaa
gtttggagagaaaaattacatgactggaaatctgctttaaatttatatgaacgtaaatta
gaagatgatcgaataaaagacaaaagttctcttattcttggtcgaatgcgatgtcttcga
gctttaggtcaatggtcagttgtattgcagtgtactacaggttcaaaatgtgccataaca
ttttactttcgacagctagttgatatcatcaactctgaaaccctatcaatatcacttaga
catgaatacatcaagttttattttattaaggttaactgtcctcgcgagatcgagggtcct
ggattcaagttcatcgtatcgagtcgtggctgcatactaatgaggagtcccacaccagaa
tttagcgcccgttcacttattccggggttccagtggtgtgtaggaaccacatggcaatct
cgcttacttggctgtaattctgtaatagaagattggagtcaaatcatccaactacgtagt
ttagtcttggaaccatatgaagatcgtagatcttggttacgctttgctggactgtgtcgt
cgaagtggtcgttttattttatcacgtcaagtattagaaaatctgttgggtttagatcca
gctggtattccaccatgtgatcctattccaagttctgatccagcaattgtatttggatat
actaaactactatgggcagttggagcgcatgaggaagcggttagtcgtttatgtgtttta
aaaacacatgtacacggtgagcgatctaacattacttgtcttcattattttcatctaatt
atttttaaactttcttttattgctagatgttgtttgaaattaggatcatggtattcagaa
ttgtatacacgttcaccacctggcggtcatcaaatagacaatcattcattagcttataca
cctaattcagtctttacagctgccagtggaaatggactacagttttccgtagctgctgca
gcacgtactttatcaaaagtgaattctaatagtgatgtgatagataatatacatccatct
caaatgtcacgtggagctggaatgcgtttatcaaataattatagtggaatagtaagatgt
atggaattacatgctgctccatctgttaagggtttcgtcaattcaataagtttgtcacca
actgctaacttacaggatagtttacgtttaatcaatttattatttaaatttggtcattta
actgaaattcgtgaagtgatacgtgaaggtttaactaaaatacgtttggataattggtta
cttgttatacaacaattattagctcgtattgatacacctagagaatatgttgctactatc
ataattgatttgttaatatctgttggacaacgttatccacagtctatggtttatccatta
gtattagcatttaaatctggtggctctgatcgtcggcgttataacgctaatcgtattctg
tacagtatggaagaacaaaattcacgtttgatatcagaagcatttttactaaatgaagaa
ttaattcgtctatcgataacatgggttgaaatgtggtcagaagcattggaagatgcaagt
cgtgtttatttcggtgagaaagatattgcgaaaatgtttcgattattacatccattacat
caaatgatggatcgtggtcatgaaacaattcatgaagcaacatttctacaagagaatggt
aatgatcttgctgaatctcgattatgctgcgaaagatatgagttaacgcaagttagaatt
gacttacagaaagcatgggaaggttattatactttgtatagacgttttgccaagcaagta
aacaacatgacaactttagaacttacagtgtcctcacctcgtttgcatgaatatggacaa
gattggcagttagcagtacctggaagttatgagcctcaccgaccacttgtaagaatagca
tcaattaagaattgtttaacttttatcacctccaaacaacgtccacgtaaattaacgatc
acaggttcaaatggtcaccaatacgtgtttttgttaaaaggacatgaagatactcgtcaa
gatgaacgtattatgcaatttttcggacttgtaaacacattgttaatcaataatccggaa
acgttacgtcgtaatttaacaattcaacggatgtctgttattccattatctacatacact
ggattgattggttgggttccaaacagtgacacattccataatttaatacgtgattatcgg
gaaaaagctgatgttgtgctaaacaaagagaatcgtgagatgcttcgtttggcaccagat
ttcgatcgtctaaatgttatacaaaaaactgaaatatttgaagctgggttaagagagtca
tctgggagagatctagctaatattttatggttaaaaagtcacagttctgaagcatggttt
gagcgtagaacgaattttacacgatctatggctaccatgtctatggttggttatattttg
gggttaggagataggcatccatcgaatataatgttgtctcgagtgacaggcaaagtggtg
catattgattttggtgattgttttgaagtggctacaatgagagaaaaattcccagagaaa
gtaccatttcggttaacacgtatgattatttctgctatggaggtgacaggaatagatggt
gtttatcgccatacctgtgaaatggttatgtctcttttacgttccaatcgtgaaagtctt
cttgcagttttagaagcatttattcatgatccattgttacagtgggtactccatgaaaac
cgtaaagaatttaatcacttagagaataagctagacgacggaggtggtggcggcggcggt
atagctccagcaattggaacaaactgtttggcaaatggtactggtggcggtgttcatggt
gtaacaactgctaataatcagtcagtacagttgaaacctggtgcacgcaattcagattat
ccacatagacaagtgtatgctcatcaacagcatcatgctgttcaaaatacacttcgacgt
ccaacagacaaaagtaataatttaacctcaggtcaacagaattcacaaggacattttcaa
cagcaaaatttgaatagaagagctaattcgccgaacagggtgtttacaaatccaaatcat
ccagacagtgcttcattgcgtgatccacaaaaggtgaatcaatggcgtcatcatttgtgt
aatggaccttggtttggttgttatgaaactgctaaacgtttaagaaagcaaatggaatcc
ggtcacatagtagttgaacgtcatggactacaagggttcatattttctgcaaaacctcca
agcactgaagactcatgtattgattcagaatcccagcctgttaccttaggaaatgtacgt
gcacgttctgtaatggaaagaattaggcaaaaattgactggcactgagagagatcaagtg
atgagcgtttcggctcaagtagacttccttatacgtgaagcaacttcaaatcaaaattta
tgccagatgtatataggctggtgtgctttctggtga

DBGET integrated database retrieval system