KEGG   Schistosoma mansoni: Smp_122960.1Help
Entry
Smp_122960.1      CDS       T01095                                 

Definition
ubiquitin-specific peptidase 30 (C19 family)
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.1.2.15]
Organism
smm  Schistosoma mansoni
Brite
Enzymes [BR:smm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Smp_122960.1
Peptidases [BR:smm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Smp_122960.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 595 aa AA seqDB search
MEFTGFSAKRVCDSLVVIIGGAVVSGAIFLLYRRANEEVYCQNFSDLPVGLPNPRNVCYF
NALMQAMAANPSLIRLLERSVYHRPDKFMYRLLCLLKGLQCSSQYIAENRLGILLKKNHE
ALINEIVNTQNWAIHEQQDAHELFGFIMERACSQDDDFSSKTYARKISNLFNFNLPHHRR
IVVCRSHCSAIESVKFRAVLCDAFPTHVFEQILWIELIGNPGTVKTNVKGLKHSHVKTSP
EVIDLIECLDAQLATVEPIPDMKCPKCQKTSTSKSCSLNYCQREQWITHTPKYLVLYIQR
SDWLNIASLSTESNNIRQFGGNPFSTTRIATKRSEHVHIPEFLDMAPYLLSCKISKTEAL
SQAVNPYNDKNSEGLLSDTSELLERDCPKPYVLRSVIVHEGAFHQCGHYITYRKWHTPML
HVQKVSYWLVHILSSLCQYVSNYFQGISNTPEAYNSPWILTSDAHVIRVPFKHVESSPAY
LLFYERLCGWDDQRFGIKSTFIANGISHRAQHSNHTLSPVEETDTGHSEIYSEDECDSDA
STDKQCVFRNLSKADIIRSYALYTSASQMYDKSCDVFYFQSVFFPTYFTVTWSSF
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggaattcactggtttttcagccaaacgagtttgtgattctctagtggtgattattgga
ggtgctgtagtttctggtgctatattcttgttatatcgacgagcaaacgaggaagtatat
tgccaaaacttctcagacctgccagttgggcttccaaatcctagaaatgtatgttatttt
aatgcattgatgcaagcaatggcagcaaatccaagtcttatccgtctcctggaacgcagt
gtctaccatcgaccggacaaattcatgtatagattgttatgtttattgaaaggtctgcaa
tgttcttctcaatatattgcagagaatagattgggtattttactaaaaaagaatcatgaa
gcgttaattaacgaaatagtgaatacacaaaattgggctattcatgaacaacaggatgct
catgagttatttggttttatcatggaacgtgcttgtagtcaagatgatgatttttccagc
aaaacatatgctagaaaaataagtaatctgtttaattttaatcttccgcatcatagacga
atagttgtctgtcgatctcattgttccgctattgaaagtgtaaagtttcgtgcagtttta
tgcgatgcatttcctactcatgtgtttgaacaaattctgtggattgaattgatagggaat
cccggcactgtaaagacaaatgtgaaaggcttaaaacattcacatgtcaaaacatctcca
gaagtgatagatcttattgaatgtcttgatgctcagttggcaactgtcgaacctatacct
gatatgaagtgccctaaatgtcagaaaacttcgacatcaaaatcctgttcattaaattat
tgtcaacgcgaacaatggataacacacactcctaaatacctagttttgtacatacaaaga
agtgattggttaaacatagctagcttatccactgaatctaataatattcgccagtttggt
ggaaatcctttttcaactaccagaattgctacaaagcgttctgaacatgtacatattccg
gagtttttagatatggcgccttatttgttatcatgtaaaatttcaaagactgaggcttta
tctcaggctgtaaatccatataatgacaaaaattctgaaggtttactttccgatacttca
gaattattagaaagagattgtccgaaaccatacgtactccgttcagttattgttcatgaa
ggagcatttcatcagtgtggacattatataacgtatcgtaaatggcacacacctatgttg
catgtgcaaaaagtgtcgtattggctagttcatattttgtcaagtttgtgtcaatacgtt
tcaaactattttcaaggaatatcaaatacacctgaagcttataattcgccatggatactg
acttccgatgctcatgtaatacgtgtgccgttcaaacacgtggaatcaagtcctgcttat
ttgttattttacgaacgtttatgtggatgggatgatcagcgatttggaataaaatcaacg
tttattgcaaacggcatcagccatcgcgcacagcatagcaatcatacgctatcaccagtt
gaagagactgatacgggtcactcggaaatatatagcgaagatgagtgcgattcagatgct
tcgactgacaaacaatgtgtttttagaaacttatcaaaagcagacatcattagatcttat
gcattatatacttcagcatctcagatgtatgataaatcatgtgatgtattctacttccaa
agtgttttctttcctacctattttacggttacgtggagtagtttttga

DBGET integrated database retrieval system