KEGG   Schistosoma mansoni: Smp_123630Help
Entry
Smp_123630        CDS       T01095                                 

Definition
ubiquitin-specific peptidase 44 (C19 family)
Orthology
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.1.2.15]
Organism
smm  Schistosoma mansoni
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 823 aa AA seqDB search
MTDNCKHVLKVKTSIQLGILSPEHWHCNNCHTTESVWACLSCSNFACGRYISEHALQHFQ
QTNHPLCIEVNEKFVYCYICDDFVLNDNAPGDIKLLRMALDAVTTQDFGKLLKQKGGRRI
LRFRGKDAEKNSLRLLKADDIQTAVVRNRTSCLSWALHLWWSRYSESRLNAVNYKKKTKS
RKIPLTLTPAFTGLRNLGNTCYMNSILQILRHTAPFANYIMNHTLSEINSHSRKRHSHPD
DLSIGDPACPVKRQATTSSFSKNQIIITNDCENSWSSLLTKTPSCSPNTENSFGHYSEPN
LVSVRKNIIPKCKSFGGLNGGQCPKFVYDCYQQSPASSLVNPQVSSIPSLYEEINNLFKL
LWSGQRSVVSPSNLLSAVWATLPTFKGYKQQDAQEFLSLLLDRLQAELHGVPMSVPSGCD
FITRAFRGYSVSHIQCSTCHVTACTEEPIYELSLSLPTKCHSDESCTFDIVDLLRQFVSP
SPIDGASYACVKCNQCSEINRKETDFTRPVFNQCSYDSNDQLGNLSYPVNKIISIALSRL
ASPSCSPQLSYPDFSTSCELTETFSLSESPLSVSSSVTGFEEQYTNPPIERSHQITQPSV
VQSPIITSPKNSPTPLPKNSLLTHATQTIRLSKLPRVLRLHIKRFRWVGRQREKLTCHVS
FPLILNMSEFVCHQSSIFTLPKEFEKSSLKYLYHLTGVVVHHGRGLQSGHYTSYCLNDNP
ECWLHCNDANVSLCDFSEVASAQAYILFYSELMPRTPFPKWYRDSIASVSSYSTTPYSVS
EPELLKNQSNSPSCSNNRENTCKNFQDNPVLQEKESKTYSTRS
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgacggataattgcaaacacgtcctcaaagtaaaaacaagcattcagttaggaatactc
tcccccgaacactggcattgcaacaattgccatacaacagaaagtgtttgggcctgtctg
tcatgtagcaactttgcatgtggtcgttatatttctgagcatgcgttgcaacactttcaa
caaacaaatcatcctctgtgtatagaagtgaatgaaaaatttgtgtactgttatatatgc
gatgattttgttctcaatgataacgcaccgggtgatattaaacttctccgcatggctttg
gatgcagtcactactcaagatttcggcaagcttctcaaacaaaaagggggcagacgaatt
cttagattccgtggtaaagacgctgaaaagaacagtttacgtctgttaaaggcagatgat
atacaaactgcagttgtccgaaacagaacttcttgtctttcatgggcattacatctttgg
tggtcaagatattctgaatcaagacttaacgcagttaactacaagaaaaagacaaaaagc
agaaaaataccactgacactaactcctgcttttacaggtttgcgcaacttgggaaacacc
tgttacatgaattcgatactgcagattttgcgtcacactgctcctttcgctaattatatc
atgaaccatacgttgagtgaaattaattctcattcaaggaagcgtcacagccaccctgat
gacttatctattggagacccagcgtgtcctgtcaagcgacaagcaacgacatcatcattt
tcgaaaaatcaaattataataactaacgactgtgaaaattcatggagttcactacttacc
aaaacaccctcatgttctccaaatacagaaaatagttttggtcattatagtgagccaaat
ttagtttctgtaagaaaaaatatcattcctaagtgcaaatcctttggtggtttaaatggc
ggccagtgcccgaagtttgtatatgactgttatcagcaatcacctgcgtcatcgctagtt
aacccgcaagtatcatcaataccttctctttatgaagaaataaataatttatttaagtta
ttatggtcaggtcaaaggtctgttgtcagtccaagtaacctcttaagtgccgtttgggcc
accctcccaacatttaaaggatataaacaacaagatgctcaggaatttttgagtttgtta
cttgaccgtttacaagcagaactacatggtgtcccaatgtctgtacccagtggttgtgat
tttatcactcgtgctttccgtggatattccgtgagtcatatacaatgttctacttgtcat
gtaaccgcttgtactgaagagccgatttatgaacttagtctttcactacccaccaaatgc
cattccgatgagtcatgtacatttgatatagtagatttacttcgtcaatttgttagcccc
tctccaattgatggagccagttatgcatgtgttaaatgcaatcagtgttcagaaataaat
aggaaagaaacagatttcacgagaccggtattcaatcagtgcagttatgattcaaatgat
cagttaggcaatttgtcttatcctgtgaataaaattatatctatcgcactgtccagactc
gcatctccatcttgtagtcctcagttatcttatcctgatttcagtacatcatgcgagtta
actgaaactttttcactgtcagaaagtccattatccgtttcttcaagtgtaactggtttt
gaagaacaatacaccaatccaccgattgaaagatcacatcaaattactcaaccatccgtt
gttcagtccccaatcatcacttcacctaagaattctccaactcctcttcctaagaactca
ttgttaactcatgcaacccaaacaattcgcctttctaaactcccacgagttttgcggcta
catattaaacgcttccgttgggttggtagacaaagagaaaagctaacatgtcatgtatca
tttcctcttatcttgaatatgagtgaattcgtctgtcatcagtcgtccatattcactttg
ccaaaagagtttgagaaaagttcacttaagtatctttatcatttgaccggtgttgtcgtg
catcatggacgagggcttcagtctggtcattatacctcttactgtttgaatgataatcca
gagtgttggttgcattgcaatgatgctaatgtatctttatgcgatttctcagaagtagca
tcagctcaggcctatattctattttattcagagctcatgccacgaacaccctttccaaag
tggtatagagattcaatagcttctgttagttcctacagcactacgccttattctgtttca
gaacccgaattattaaaaaatcagtctaacagtccatcatgctctaacaatcgtgaaaat
acttgtaaaaatttccaagacaatcctgtattacaggaaaaagaatcaaaaacatattcc
accagaagttaa

DBGET integrated database retrieval system