KEGG   Schistosoma mansoni: Smp_123650Help
Entry
Smp_123650        CDS       T01095                                 

Definition
(RefSeq) peroxidasin
  KO
K19511  
peroxidase [EC:1.11.1.7]
Organism
smm  Schistosoma mansoni
Brite
Enzymes [BR:smm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     Smp_123650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 617 aa AA seqDB search
MKTNYSEVQMNDNTNYTDNKLFDEDNKFSGMLMQWGQFLDHDLDFTPVDASTSRFSDGLG
CNETCINDPPCFPILIPPDDPRIKHRCIGFSRSSATCGSGSTSILLGKPRYREQLNQITA
FIDASNVYGSDDFENSQLRETLFDEGKMREGMPTEAGKSLLPFNIRGQVDCQADPKQDFV
PCFKAGDHRSNENLGLLSLHTLWLREHNRLADSLRTLNPHWSGDRIFNEARKIVGASMQA
ITYQYWLPMILGADGMELLGEYNGYDYQINPTISNEFATAAMRFGHTMVPPIVFRLNENW
ETIDQGHLLLHQAFFAPDRLLKDGGMDPILRGLLFNGIRDRSRNPSLNSELTERLFAMAH
ELALDLAALNVQRGRDHGLPGYTEYAYKICGLGSSAHPDSFNELKSRISKPYILEGLRRV
YGHPGNIDLFTGGILEDLLPDARVGPTFACIIAEQFRKLRSGDRFWYEAPGIFSSAQLAE
IKRAGSSLSRIICENSDNITEVPENAFIRPNGRKDLIDCSRIPRLNLAVWKECPFTSGFL
SPHHGTAYITDTGKLEQTESLLVKRYRRDTITNENISSENKNNHSETEQLALLSKRIKQL
EDQISILMKKKLDPNET
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaactattcagaagttcaaatgaacgataatactaactatactgataacaaa
ttatttgatgaggataataaattcagcggaatgttaatgcagtggggacaatttttagat
catgatttagattttacaccagtcgatgcatcaaccagtcgatttagtgatggtctcgga
tgtaatgaaacatgcattaatgatccaccatgttttccaatactgattcctccagatgat
ccacgcattaaacatcgttgtattggattttcacgatctagtgcaacttgtggttctggt
tcaacatcaattttattaggtaaaccaagatacagagagcaattaaatcaaatcacagca
tttattgatgcatccaatgtatatggaagtgatgattttgaaaatagtcaattgagagaa
acactttttgatgaaggcaaaatgagagaaggcatgccaacagaagctggtaaatcttta
ttacctttcaatattcgaggacaggttgattgtcaagctgatcccaaacaggattttgta
ccatgtttcaaagctggtgatcatcgtagcaatgaaaatcttggtttattatcattacat
actttatggttaagagagcataatcgattagctgacagtttacgaacattaaatccacat
tggtcaggtgacagaatatttaatgaggctagaaaaattgtaggtgcatccatgcaagca
attacttatcagtattggttaccaatgatattaggtgctgacggaatggaattgctagga
gaatacaatggatatgattatcaaattaatccaacaattagtaatgaattcgctacagcc
gcaatgagattcggtcatactatggtgccaccaattgtgtttagattgaatgaaaattgg
gaaactatagatcaaggtcacttgctgctacatcaagcattctttgcacctgatcgatta
cttaaagatggtggtatggatcctatattaagaggtcttttatttaatggtatacgtgat
cgttcaagaaatccatcattgaatagtgaattaactgagagattatttgctatggctcat
gaacttgcactggatttagcagcacttaatgttcaacgtggacgagatcatggactacca
ggttatacggaatatgcatataaaatttgtggattaggtagttcagcgcatccagattca
ttcaacgaattaaaatcaagaatttcaaaaccgtatattttggaaggattacgaagagtc
tatggtcacccaggcaatatagatttatttacaggtgggatattagaagatcttcttcca
gatgctcgagttgggccaacatttgcttgtatcatagcagagcaatttcgtaaacttcgg
tcaggtgatagattttggtatgaagcacctggtatattttcatcagctcagttagccgag
atcaaacgtgcaggatctagtttatcacgcattatatgcgaaaactcagataatatcact
gaagtccctgaaaatgcattcattcgacctaatggtagaaaagatcttatcgattgtagt
cgtataccaagattaaatttagccgtatggaaagaatgtccatttacaagcggtttctta
agtccacatcatggtacagcttatattactgatactggtaaattagaacagactgaatct
ttattagtcaaaagatatagacgtgatactataactaatgaaaatatttcatcagaaaat
aaaaataatcacagtgaaacagaacaattagcgttattgtcgaaacgaattaaacaattg
gaagatcaaatatctatattaatgaagaaaaaattggatccaaatgaaacgtaa

DBGET integrated database retrieval system