KEGG   Schistosoma mansoni: Smp_123710Help
Entry
Smp_123710        CDS       T01095                                 

Gene name
acc1
Definition
acetyl-CoA carboxylase (EC:6.4.1.2)
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
smm  Schistosoma mansoni
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Smp_123710 (acc1)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Smp_123710 (acc1)
   00640 Propanoate metabolism
    Smp_123710 (acc1)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Smp_123710 (acc1)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    Smp_123710 (acc1)
Enzymes [BR:smm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Smp_123710 (acc1)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Smp_123710 (acc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 2576 aa AA seqDB search
MAVTQDVHNVNWQLGRSDDNSEFSSHTLAKPSSNFKVRFSSPEDFVRKSGGVRIIEKILI
ANNGIAAVKCMRSLRKWSYATFGSSDVLRFVCMATPEDIQANAEYIKMANKMVLVPGGSN
VNNYANVELILQTAVTNEVDVKFQCVYLYTFLYNFSLFSLGPSHQAMWTLGDKVASTILA
QSAHVPTLPWSGSVDNLTLNMVKSTGLPQRSSSVYSRLISEDLYRSGCVTDVSSCLKCAE
KIGYPVMIKASAGGGGKGIRKALTSADIERFFPQVQAEVPGSPIFVMKCATSVRHLEVQI
LCDIYGQAISMFGRDCSVQRRHQKIIEEAPIIVAPKEIIEQMEQAAVRLSKLVSYVSAGT
VEYLYDPDSNQFYFLELNPRLQVEHPCTEVVAEVNLPACQLQIAMGIPLHRIKDIRELYL
APPWSDSIIDFNDPSINRRPPSCYVIAARITSEDPDEGFKPRPGGVRELNFRSNQSVWGY
FSVSSAGGIHEFADSQFGHIFSAGENREHARENMVLALKELSIRGDFRTTVEYLIKVMEC
EAFMNHKINTEWLDARIAQNDQVEKPDILLGVICTALHIADNCLKQLFLNYELHLERGQF
LPSKTLTNSVDVTLVSDSTKYIVRVLRTGPSNFSLICCDTVLDLEVHRVPGDGLLVCHEA
ASYMTYCHEESQGYRTVINNRTMMLCKETDPTVLRSHSAGKLLQYCVTEGSHVCANEVYA
LIEVMKMIFELRVPTSGIITLKRIPGAILEPGTELARIELDELNQLKPLQIFSPNSGGDP
MLMLTNSTTNGKLHLQFTRLLASLEQILFGYCLCEPYFSKSLMKTLNQFLTLLYNPRLPL
HELQDTIAHLKGQLPSSMEKSLRLHAKLYADQATSVLANFPSEAIIQITDEYLKQINNGQ
LTDCSVLEFQRITQRLIDLAERYKHGLRGHTVRVISQLFMGYVVIEKHFQHGQYDKCIRH
LLAKCQGSTLWDIVSVIFSHRQLIMKNVLIINLIQSLIERRELCMTDQLQCCLKALTELG
GTRNSKVALTARQLLISVQTPSYELRRNQVESIFLSAIDTFGQQIHPELLLQLINSETVV
FDILTDFFYHPNHAVASAALEVYIRRSYTAYELTGVHHFQLSCGSSFFTFRFLLPNEFVS
RQDIRLPTKGRVYCSAVCSFLLYGSETCPIRVDDIPRLLVFDHRCLRSIARISWDHRVSN
AVVSKRVLYKYIQPNGISSSSSNDDTSAPSKSKPSGFNKNSLLLPDSVINETSDVTHLEK
FCSRHVDQLRASGIRRITFLVVKTREFPRLYTFRARDNYREDRVYRHLEPALAFQLELNR
MKNYNLDYLPTLNRRMHLYLGCSKINGRKDVVDYRFFVRCIIRHADLVSREASFEYLQSE
AEQILLEAMDALDLASGHPDASRTMGNHIFLNFVPVLLLEDINRLKSTIRKVVMRYARRF
LRLRVSQAELKLHIRFHASDPIVPIRVMLRDEHGYDLGLDVYREVLDPVTGICILQSISP
LNGRLNGHPAVRAHENKDFFEVKRFQARKFNTTYVYDYPALLAQALTGVWQSYCPYINGK
HADLTSISDHTMNDSFNESNSSFKSNSLSKFHGLIPLNIPENLVITCTELSLDKYGNLQP
NTNTLGTNEIGMVVWYMVLRTPETPSGRPIIVTANDATFQAGSFGPAEDLTFHRASQLAR
YFRIPQIYLASNTGARIKIAEDIKNVFNIAWIDAEHPEKGYKYLYLTPDDYYRFKYDEAV
NCERIEENGEIRYKIIDIIGKEYDMSAENLRGSAMIAGETSAAYDDIFTITIVTNRAIGI
GAYLTRLGQRVIQVNNSHIILTGAMALNKLLGREVYSSNSQLGGVQVMATNGVSHLVASD
ELSALQLAIEWLSYIPQFHQPKVNKQTDFYLPFDPIDRIVEYIPSRDRPNDDPRWMFTGI
MSNKQPSLSDQQFENANTDHWISGFFDWGTWQETLSSWAAGVVTGRARLGGIPCGVITAE
TRSVVCRVPADPANLSSEAQIVNQAGQVWYPDSAYKTAQAIADLSREHLPLFIFANWRGF
SGGMKDMYDQVLKFGSMIIDSLRRYTKPVFVYLPPNSQLRGGAWVVVDPAINPDFMEMYA
DPISSRAGVLEPEGTVEIKYRQKDLINTINRLDDTCKLLLKELNHLNEHTNNLSMNDDQD
VPLLFFLFFHIFVVSVCFFLKVACKFADLHDTPGRLLARKLVHRLVDWSSSRCFFYTRLR
RRLLELSALNLITNILSNSSDPYPIDTKYTTTTGNTTNHNVPFLNFNCETNKSKEISLKE
EEETEFKQSSVKLLRVASNHRIRFDSESLTQTVTTNDIPNNSDGRYSLSTTTLKSTVCNK
EEVANIIAKQVPNLAISYTYHTNQKMSLLKSWFIEALNNANHKTNNGMPVSVNNKCLHIT
TGHEDVPDKVDDEQNTTTSSPEPLKLLNPYEIWDNNDLIVGNWLANELNCNELRDLATIE
NVQEFCSPDTLNCLSFTSINNSPTTNSNLQLFEQNIIKTKIKQLHKDNLIEHVKQSLINS
SQLSSNELITLFKTVLTSSERCHLAKLLLSDSTIKIDDINNNNDHHDDNMNGQCNT
NT seq 7731 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcacacaggatgttcacaatgttaactggcaattgggtcgttcggacgacaac
tcagagtttagttcgcatacattggccaagccttcatcaaatttcaaggttcgattttct
tcacccgaagactttgtgcgtaaatcaggcggtgttagaataatcgagaagattctgatc
gctaacaatggtatagcagcagtgaaatgtatgcgttctttacgaaaatggtcatatgct
acattcggtagttctgatgttttacgtttcgtatgcatggcaacaccagaagatatacaa
gctaatgctgaatatatcaaaatggcgaataaaatggttctggtaccgggtggttctaat
gtaaataattacgctaatgttgaactaattctacaaactgctgtaactaatgaagtggat
gtaaagtttcaatgtgtttatctttatacttttttatataatttctcattattttcctta
ggtccctcgcatcaggctatgtggacacttggtgacaaagttgcttctacaatacttgct
caaagtgcacatgtacccactcttccttggagtggttctgttgacaatttaacattgaat
atggtaaaatctactggtctaccacaaagatcatcatctgtatattctcgtttaatatct
gaagatttatatcgttctggttgtgtaacagatgtatcaagttgtttaaaatgtgccgaa
aaaataggctatccagtgatgatcaaagcttctgctggtggtgggggtaaaggaattaga
aaagcgttaactagtgcagatattgaacgtttttttcctcaagtacaagctgaagtacct
ggttcacctatttttgttatgaaatgtgcaacatctgttcgtcatttagaagtacaaata
ctttgtgatatatatggtcaagcaattagtatgtttggtcgtgattgttcagttcaacga
aggcatcaaaaaattattgaagaagcacctattattgtagctccaaaagaaattattgag
caaatggaacaagctgcagtacgtttatctaaattagttagttatgttagtgctggaact
gtggaatatctatacgatcctgattcaaatcaattttatttcttagaattaaatccacga
cttcaagttgaacatccatgtacagaagtagttgctgaagtaaatttaccagcttgtcag
ttacaaattgctatgggtatacctttacatcgtatcaaagatattcgtgaactttatcta
gctcctccatggtctgattcaattattgactttaatgatccaagtattaatcgtcgtcca
cctagttgttatgtaattgctgctcgtattacaagtgaagatcctgatgaaggttttaaa
ccacgtcctggtggtgtaagagaattaaattttcgaagtaatcaatcagtttggggatat
ttcagtgttagtagtgctggtggaatacatgaatttgctgattcacaatttggtcatata
ttctcagcaggtgagaatagggaacatgcacgcgagaatatggttttagcattgaaggaa
ttatctattcgtggtgattttagaactacagttgaatatcttatcaaagtaatggaatgt
gaagcttttatgaatcataagattaatacagaatggttagatgcacgaatagcacaaaat
gatcaagttgaaaaaccagatattctacttggtgttatatgtactgctttacatattgca
gataactgtttaaaacaattatttcttaattatgaattacatttagaaagaggtcaattt
ctgccctcgaaaactctgaccaatagtgtggacgtaactttggtatcagattctacgaag
tatattgtcagagttctacgtactggaccatcgaattttagtcttatctgttgtgatact
gtattagatttggaagtgcatcgtgtgcctggtgatggtttattggtttgtcatgaagct
gctagctatatgacttattgtcatgaagaatctcaaggttatcgcacggtaatcaacaat
cgtacgatgatgctgtgtaaagaaactgatccaactgttttacgatctcattctgctgga
aaacttcttcaatattgtgttactgaaggatcacatgtttgtgcaaatgaagtatatgct
cttattgaagtgatgaaaatgatatttgaactacgtgttccaacttcaggtattatcact
ttgaaacgtattcctggagcaattcttgaacctggtacagaactggctcgtattgaatta
gacgaattaaatcaattgaaacctttacaaatatttagtcctaattccggtggtgatcca
atgttgatgcttactaattcaactactaatggaaaattacatttacaatttactcgattg
ctggcatcattagaacaaattttatttggttattgtttatgtgaaccatattttagtaaa
tcattaatgaaaacattaaatcaatttcttacattgttatataatccacgtttaccactt
catgaattacaagatacaatagcacatttaaaaggtcaattaccatctagtatggaaaaa
tcattacgtttacatgctaaactttatgcagatcaagctacatcagtattagctaatttt
ccatcagaagcaattatacaaataacggatgaatatttaaaacaaattaataatggacaa
ttaacagattgttctgtattagaatttcaacgtattacacaacgtttaattgatttagca
gaacgttataaacatggtctacgtggtcatactgttcgtgttatatcacaattatttatg
ggttatgttgttattgaaaaacattttcaacatggtcaatatgataaatgtatacgtcat
ttattagctaaatgtcaaggatcaacattatgggatattgtttcagttatattttcacat
agacaattaataatgaaaaatgtattaattataaatctgatacaatcattaattgaaaga
cgtgaattatgtatgactgatcaattacaatgttgtttaaaagcattaactgaattaggt
ggtacaagaaattctaaagtagcattaacagcacgtcaattacttatttctgtacaaaca
ccatcatatgaattaagaagaaatcaagttgaatcaattttcttatctgccatagataca
tttggtcaacaaatacatccagaattattattacaattgattaattctgaaacagttgta
tttgatatattaaccgatttcttttatcatccaaatcatgctgtggcaagtgctgcatta
gaggtttatattagacgttcatatacagcgtatgaattaaccggtgttcatcatttccaa
ttatcttgtggaagttcatttttcacatttagatttttgttaccaaatgaatttgtttct
aggcaagatatccgtctaccgaccaaaggacgtgtttactgctcagcagtttgttccttc
ttactttatggcagtgaaacatgtccgataagagtagacgatattcctagactactagtt
ttcgatcataggtgtcttcgaagcattgctcgtatatcttgggaccaccgggtaagtaat
gcagtcgttagtaaacgggtactgtacaaatatatacaacctaatggtatatcgtcatca
tcatcgaatgatgatacgtcagcgccgtctaaatcaaaaccttctggattcaataaaaac
tcattattattacctgattcagtaattaatgaaacaagtgatgtgacccatttagaaaaa
ttctgttctcgtcatgttgatcaattacgagcatccggcatacgtagaattactttctta
gttgttaagacacgagaattcccacggttatatacatttcgtgcacgtgataattatcgt
gaagatcgagtttatcgacatttagaaccagctttagcttttcaattggaattaaatcga
atgaaaaattataatcttgattatttaccaacattaaatcgtcgtatgcatttgtattta
ggttgtagtaagataaatggacgaaaagatgtagtagattatcgtttctttgttcgttgt
attattcgtcatgctgatttagtttcacgtgaagcttcatttgaatatcttcaatcagaa
gctgaacaaattcttttagaagcaatggatgctttagatttagcttcaggacatcctgat
gctagtcggacaatgggaaatcatatctttttaaatttcgttcctgtattacttttagaa
gatattaatagactaaagtcaacaattagaaaagttgtaatgcgttatgctcgacgtttt
ctacgtttacgtgtttctcaagcagaactaaaattacatattcgatttcatgcatctgat
cctattgtaccaattcgtgttatgcttcgtgatgaacacggttatgatttaggattagat
gtttatcgtgaagtattagatccagtaactggtatttgtattctacaatcaataagtcca
cttaatggtagattaaatggacatccagctgttagagctcatgagaataaagattttttt
gaagttaaacgtttccaggcaagaaaatttaataccacttatgtttatgattatcctgca
ttattagctcaagcattaactggtgtatggcaaagttattgtccatatataaatggtaaa
catgctgatttaacatccatatcagatcatactatgaatgattcattcaatgaatctaat
tcatcattcaaatcaaattcattatcaaaatttcatggtttaatacctttaaatatacca
gagaatttagtgattacatgtacagaattatcattagataaatatggtaatttacaacca
aatacaaatactttaggtacaaatgaaattggaatggttgtctggtatatggtattacgt
acaccagaaacgccatctggtcgtccaattattgttacagcaaatgatgcaacatttcaa
gctggatcatttggtcctgctgaagatttaacatttcatcgtgctagtcaattagctcga
tattttcgtattccacaaatttatttagcatcaaatacgggtgcacgaataaaaattgct
gaagatattaaaaatgtattcaatattgcttggattgatgctgaacatcctgaaaagggt
tataaatatttatatttaacaccagatgattattatcgttttaaatatgatgaagctgta
aattgtgaacgaattgaagagaatggagagatacgttataaaattattgatattattggc
aaagaatatgatatgtctgcagagaatcttcgtggttcagcgatgattgctggagaaaca
tctgcagcgtacgatgacatattcactattacaatagttacaaatcgtgctatcggtatt
ggagcttatttaacacgtcttggtcaacgggttattcaagtaaataattcacatattata
ttaactggtgcaatggctcttaataaacttcttggtcgtgaagtatattctagtaatagt
caattaggtggtgtacaggtgatggcaactaatggtgtttctcatttggttgcatcagat
gaactctccgctttacaattagctattgaatggcttagttatataccacaatttcatcaa
ccaaaagtgaataaacaaactgatttttatttaccatttgatcctattgatcgaattgtt
gaatatatacctagtcgtgatcgaccaaatgatgatcctcgttggatgtttactggtatt
atgagtaataaacagccttcgttatctgaccagcaatttgaaaatgcgaataccgatcat
tggatatcaggatttttcgactggggaacatggcaagaaactttgtcatcctgggctgcc
ggagttgtgactggtcgagcacgtttaggtggtatcccatgtggtgttatcacagcagag
acaagatctgttgtttgtcgtgtacctgctgatccagctaatttatcctctgaagcacaa
attgttaatcaagctggtcaagtatggtatcctgattcagcgtataaaactgcacaagct
attgctgacttgtcacgtgaacatttacctttattcattttcgctaactggcgggggttt
tctggtgggatgaaagatatgtatgaccaagtattaaaatttggttcaatgattattgat
tcattacgtcgttatactaaaccagtatttgtttaccttccaccaaattcacaattacgt
ggtggtgcttgggttgtagtagatccagctattaatccagattttatggaaatgtacgca
gatccaatatcatcacgtgctggtgtacttgaacctgagggtacagttgaaattaaatat
cgacaaaaagatttaattaatactattaatcgattagatgatacatgtaaattattatta
aaggaactgaatcatttaaatgagcatacaaacaatttatcaatgaatgatgatcaagat
gttcctcttttattttttctgttctttcatattttcgttgtatctgtgtgtttcttcctg
aaggtggcttgcaaatttgctgatttacatgatacacctggtcgtttattggctagaaaa
cttgttcatcgtttagttgattggtcatctagtcgttgttttttctatacacgtcttaga
cgtcgtctactagaattatcagcattgaatttgattactaatatattatcaaatagttct
gatccatatccaattgatactaaatatactactactactggtaatactactaatcataat
gtaccatttttaaattttaactgtgagacgaataaaagtaaagagatttcattgaaagaa
gaagaagagacagagtttaaacaatcatcagttaaactacttcgtgttgcaagtaaccat
agaatacgttttgattcagaaagtttaacacaaactgttacaactaatgatatacctaat
aattccgatggaagatattcactttctacaaccactttgaagtctaccgtttgtaataaa
gaagaagttgctaatataattgctaaacaagttcctaatttagctatcagctatacatat
cacaccaatcaaaaaatgtcacttttaaaatcatggtttattgaagcattgaataatgct
aatcataaaacaaacaatggtatgccagtttcagtaaacaacaaatgtttacatataaca
actggtcatgaagatgtaccggacaaagtagatgatgaacagaacacgacaacatcttca
cctgaacctcttaaattattgaatccttatgaaatatgggataataatgatttaattgtt
ggtaattggttagcaaatgaattaaattgtaatgaattacgtgacttagcaactattgaa
aatgttcaagaattctgttcaccggatacattaaattgtctttcatttacttcaatcaat
aattcccctactactaattctaatctacaattatttgaacaaaatattataaagacaaaa
attaaacaattacataaagacaacttgattgaacatgttaaacaatcccttattaatagt
tcacaattatcatctaatgaattaattacattatttaaaactgttctaacatcatcagaa
cgttgtcatttagctaaactacttttatcagattctacaataaaaatagatgatataaat
aacaataatgatcatcatgatgataatatgaatggacaatgtaatacatga

DBGET integrated database retrieval system