KEGG   Schistosoma mansoni: Smp_124360Help
Entry
Smp_124360        CDS       T01095                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
smm  Schistosoma mansoni
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Smp_124360
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Smp_124360
Enzymes [BR:smm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Smp_124360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 175 aa AA seqDB search
MFDRFTSLLSLIIFLANSEACMRSPASGKIYDFTVTDIDGNEVQLKKYLNKVCIIVNVAT
EUGLAGTNYPQLQRLYTQYSENGFRILAFPCNQFRGQEPGTDQEIKQRVLAKYNVTFDLF
HKIDVNGENAIPLYKFLKQSISSWFSRDIEWNFVKFLVDRNGTPVSRYSSITPPN
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatcgttttacaagtttgttaagcttgataatcttcttggccaattcggaagct
tgcatgagaagtccagcatctggtaaaatctatgattttactgtcactgatattgacggt
aatgaagttcaactgaaaaagtacctaaataaagtttgcataatcgtgaatgttgctact
gagtgaggccttgcaggcactaattatccccagcttcagagactatatacccaatattct
gaaaatggcttccgaattttagcttttccttgtaatcagtttagaggacaggaacccgga
actgatcaagaaataaaacagcgcgtgttagcaaagtataatgtaacattcgatttgttc
cacaaaattgatgttaatggtgaaaatgctattccgttgtacaagtttctgaaacagtca
atatcgtcttggttttccagagatattgaatggaattttgtgaaatttctagttgacaga
aacggtactcctgtatctcgttacagttcgataactccccccaat

DBGET integrated database retrieval system