KEGG   Schistosoma mansoni: Smp_128770Help
Entry
Smp_128770        CDS       T01095                                 

Definition
(RefSeq) ubiquitin-specific peptidase 4 (C19 family)
  KO
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11 [EC:3.4.19.12]
Organism
smm  Schistosoma mansoni
Brite
Enzymes [BR:smm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Smp_128770
Peptidases [BR:smm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Smp_128770
Ubiquitin system [BR:smm04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Smp_128770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
GeneDB: 
Position
2
AA seq 872 aa AA seqDB search
MSVATFTACFKKVAVRNGFTLVNVSSTSGFRNCISAATFTTQKAKVDELMNVEITKGDLW
YILSLNWWTKWEEFVDSVSKSGIVDETSEEYPGKVDNSDILYDGKLKENLLLESDITLIP
RNVWKLFVDFYGCTHTDISVFERRAIQAPKSAEIEIYPPHYSFYLNPSNSSATLLFEGTY
CKFQTIRELKAIVAQHLKAAPGVNVHLSIHNEQNEFEELEDEDATIEETNLEREKVIFVQ
LEPRNGIRSDISVNSSRLKSNDSIGSQPESQMLSLHGSGPPLVPGVCGLNNLGNTCFMNS
ALQCMSNVPALTSYFLSGKWKSELNIRNPLGSQGRIATAYADLIKQLWSGTRAYAVPREF
KIEIARIARQFSGYAQHDTHELLVFLLDGLHEDLNRIHSKPYIEVKDSDGRPDIEVANEA
WEYYKSRNDSIIVDLFHGQLKSTVICPTCQRKSVTFDPFASLILPIQEVYKYTVRVYVWP
WKSNKSQLLLLELTLSTIPCGQNIIEALEQERPPLPGCQYYIPNKSVDRSRYASLIAYEL
TEGFPIPVLWTNDNIAQGINFPIYISLPINDDVKGMTITVSEDILIKHIIDRLHAIGITS
EPTVSSVSDASKLEEENANNSVVSCSLSDFHSNPQPDKPNTTSTDLFDQSKQTTEGTTVN
LASLLKGRLCLKDTRGHDWLAESENTLISLPCSDAYSIILDCQSLEIRRRLNDIRSHIQQ
HPVTRLNETLKLSDCFERFTDIEQLGSRDLWYCSRCKAEKPATKKFDLWKLPDVLVVQLK
RFRSHLRFHDKIDTLLEFPLTGLNLTSRVLEKKPDEKFIYDLVAVSNHMGYLGGGHYTAF
ALNAHTNRWYFFDDSSTRECDPSKIVLVQHMC
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttgcaactttcaccgcttgttttaagaaagttgcggttaggaatggtttcaca
ctcgtaaacgtttcatctacttctggttttagaaactgcataagtgctgccactttcact
actcaaaaagccaaagttgatgagttaatgaatgtggagataacaaaaggagacttatgg
tatatcctgtctcttaactggtggacgaaatgggaagaatttgtggactcggtttccaaa
agtggaatagtggacgaaacctctgaagagtatccaggaaaagttgataacagtgacatt
ttatatgatggaaaattaaaagaaaacttgctcttggaaagtgacatcacgttaatacct
aggaatgtgtggaagctgtttgttgatttttatggttgtacacatacagacatttctgtc
ttcgaacggcgtgccatccaagcaccaaagtcagcggaaatcgaaatatatccaccccac
tactcattctacctaaatccttcaaactcaagtgccactttgctgtttgaagggacatat
tgcaaatttcagacaataagagaacttaaagcgatagtcgcacaacaccttaaagcagca
cctggcgtgaatgtccacttatcaatacacaatgaacaaaacgaatttgaagaactggaa
gatgaagatgctaccatagaagaaactaatctggagcgtgaaaaagtcatttttgttcag
ctggaacctagaaatggaatacgcagtgacatatccgtaaatagttcgcgtttgaagtcg
aatgactctataggatctcaacctgaatcccagatgctatctttacatggatccggtcca
cctttagtaccaggagtttgcggtcttaataacttgggaaatacatgttttatgaatagt
gctcttcagtgtatgtccaatgttcctgcattaaccagttacttcctaagtggcaaatgg
aagtctgaactaaatatacgtaatccacttggatctcaaggaagaattgctactgcttac
gcagatctcattaagcagctctggtcggggacgcgagcatatgctgtgcctcgtgaattt
aagattgaaattgcacgtatcgctcgtcaattttctggatatgctcaacatgacactcat
gaactacttgtattcttattggatggacttcatgaggacttaaatagaatacactccaag
ccttatattgaagtgaaagattccgatggtagaccggatattgaggttgcaaatgaagcc
tgggaatattacaagtcaagaaatgattctataattgtagatctttttcatggacagctg
aagtccaccgtgatttgtcctacttgtcaacgtaaatcagtcacttttgatccatttgct
tcattaattctgcctatacaagaagtatacaaatatacggtacgcgtttatgtttggccg
tggaaatccaataaatcccaacttcttctattagagttaacactttccacaataccttgc
ggtcaaaatattattgaggcattagaacaagagcgtccacctcttccaggttgtcagtat
tatataccaaacaaatctgtagatcgttcaaggtatgcctccctgattgcttatgaactg
actgaaggtttcccgattcctgtactctggacaaacgacaatattgcccagggtatcaac
ttccctatctatattagtttaccaataaatgatgatgttaaagggatgaccattaccgtc
tcggaagatatactgatcaaacacattatcgaccgtttgcatgctattggtataactagt
gaaccgactgtatcttcggtcagtgacgcgtcaaagttagaggaggaaaatgcaaataac
tcagttgtttcttgttcgctaagcgactttcacagtaatccccaaccagataaaccaaat
acaacctcaaccgatctttttgaccagtcaaaacaaactactgaaggaacaacggtcaat
ttagcctcattactcaaaggacgtttatgcctgaaggatacgagagggcatgattggtta
gctgaatcagaaaatactttaatatctctcccttgttctgacgcttatagtatcattttg
gactgtcaaagtttagaaatacgacgtagactcaatgacattcgaagtcacatacaacaa
catcctgttacgcgacttaatgaaaccctaaaactttcagattgtttcgaacgttttact
gatatagaacaattaggttcaagagatctgtggtactgtagtcgctgcaaagcggaaaaa
ccagctacaaaaaaatttgatttatggaagcttcctgatgttcttgtagtacaattaaag
cgtttccgatctcacttacgatttcatgataagatcgatactttactggaattcccacta
actggcttaaatttgacttcacgtgtacttgaaaagaaaccagacgagaaatttatctat
gacttagtagctgtaagcaatcatatgggatatttgggtggaggtcattatacagcattt
gctttaaacgctcacactaatcgatggtactttttcgatgattcttcaacacgagaatgt
gatccttccaaaattgtactagtgcagcatatgtgttag

DBGET integrated database retrieval system