KEGG   Schistosoma mansoni: Smp_133600Help
Entry
Smp_133600        CDS       T01095                                 

Definition
(RefSeq) putative utp-glucose-1-phosphate uridylyltransferase 2 (udp-glucose pyrophosphorylase 2)
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
smm  Schistosoma mansoni
Pathway
smm00040  Pentose and glucuronate interconversions
smm00052  Galactose metabolism
smm00500  Starch and sucrose metabolism
smm00520  Amino sugar and nucleotide sugar metabolism
smm01100  Metabolic pathways
Module
smm_M00361  Nucleotide sugar biosynthesis, eukaryotes
smm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Smp_133600
   00052 Galactose metabolism
    Smp_133600
   00500 Starch and sucrose metabolism
    Smp_133600
   00520 Amino sugar and nucleotide sugar metabolism
    Smp_133600
Enzymes [BR:smm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Smp_133600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 8341079
NCBI-ProteinID: XP_018650564
GeneDB: Smp_133600
UniProt: G4VDL3
Position
2
AA seq 469 aa AA seqDB search
MISFKELFKQYLHDKTEKFDWNMMEPVPSESIKMYDALHVPTDREVIRQQLNKLVMVKLN
GGLGTTMGCTGPKSLISVRSNLTFLDLTVQQIERLNNEYGTNIPLVLMNSFNTHTETEKV
LRKYQQVNVQILTFLQSCYPRLNRESLLPIAKCAGQESHDSGTKTSKDMNYNPEEWYPPG
HGDFYRSFVACGLAEKMIAIGKQWVFMSNIDNLGATVDLNILNFLMNKEFHCGKQSPEFV
MEVTDKTRADVKGGTLTQYRGHLRLLELAQVPEEHVDDFASVRTFKIFNTNNLWIDLQAL
HRSVKQKTLQMEIIVNPKTLDSGTNILQLEEAAGAAIKSFNGAFGVNVPRSRFLPVKTTS
DLLLVMSNLYVLDGGSLSLSPLRSFPSVPLVKLGSHFKKVKDFLSRFTSIPDLLELDHLT
VSGDVYFGKGVVLKGTVIIIANFGNLINIPPGSILENKIVSGNLRILDH
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgatatctttcaaggagttgtttaagcaatatttacatgataaaacagaaaaatttgat
tggaatatgatggaacctgttccatctgaaagtatcaaaatgtacgatgcccttcatgtt
cctactgatcgtgaagtaattcgtcaacagttaaataagctagtaatggtgaagctaaat
ggtggcttgggcaccacaatgggttgtactggaccaaaatctttaatttcagtccgaagt
aaccttacttttcttgacctgactgtacaacaaatcgagagactaaacaatgaatacgga
actaatattcccttggttctgatgaattccttcaatacacatactgaaactgaaaaggtt
ttacgcaaatatcagcaagttaatgttcaaattttgacatttttacaaagctgctatcct
cgtctgaatcgagagtcattacttcctattgctaaatgtgctggtcaagaaagtcatgac
tctggaacaaagacttctaaagatatgaactataatcctgaagaatggtatcctcctgga
catggtgatttctatcgtagttttgttgcttgtggattagctgagaaaatgatagctatt
ggtaaacaatgggttttcatgtcaaatattgataatcttggggcaactgttgatctaaat
attctaaattttttgatgaataaagaatttcattgtggcaaacaatccccagagtttgtt
atggaagtaactgataaaacacgagctgatgttaaaggtggcacattaacacaatatcgt
ggacatctaagacttttagaattagctcaggtccctgaagaacatgttgatgatttcgct
agtgtacgaacatttaagatatttaatactaataatctttggattgatttacaagctttg
catcgtagtgttaaacaaaaaactctacaaatggaaatcatagtcaatcctaaaacttta
gattccggtacgaatatattacaattggaagaggctgcaggggctgctatcaagtcattt
aatggtgctttcggtgttaatgttccacgaagtcgtttcctaccagttaaaactacttca
gatttattgttagtaatgtctaatttatatgtattagatggtggaagtttatcattgtct
ccattgcgaagtttcccatctgtgcctttagtaaaacttggtagtcattttaaaaaagtc
aaagattttttaagtcgatttacaagtataccagatctactggaattggatcatttaact
gtatccggagatgtatactttggaaaaggagtagttttaaagggtacagttattataatt
gccaattttggtaatctcattaatataccaccaggttcaatattagaaaataaaattgtt
tcaggaaatctacgcattttagatcattaa

DBGET integrated database retrieval system