KEGG   Schistosoma mansoni: Smp_133600Help
Entry
Smp_133600        CDS       T01095                                 

Definition
utp-glucose-1-phosphate uridylyltransferase 2 (udp-glucose pyrophosphorylase 2)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
smm  Schistosoma mansoni
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Smp_133600
   00052 Galactose metabolism
    Smp_133600
   00500 Starch and sucrose metabolism
    Smp_133600
   00520 Amino sugar and nucleotide sugar metabolism
    Smp_133600
Enzymes [BR:smm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Smp_133600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 469 aa AA seqDB search
MISFKELFKQYLHDKTEKFDWNMMEPVPSESIKMYDALHVPTDREVIRQQLNKLVMVKLN
GGLGTTMGCTGPKSLISVRSNLTFLDLTVQQIERLNNEYGTNIPLVLMNSFNTHTETEKV
LRKYQQVNVQILTFLQSCYPRLNRESLLPIAKCAGQESHDSGTKTSKDMNYNPEEWYPPG
HGDFYRSFVACGLAEKMIAIGKQWVFMSNIDNLGATVDLNILNFLMNKEFHCGKQSPEFV
MEVTDKTRADVKGGTLTQYRGHLRLLELAQVPEEHVDDFASVRTFKIFNTNNLWIDLQAL
HRSVKQKTLQMEIIVNPKTLDSGTNILQLEEAAGAAIKSFNGAFGVNVPRSRFLPVKTTS
DLLLVMSNLYVLDGGSLSLSPLRSFPSVPLVKLGSHFKKVKDFLSRFTSIPDLLELDHLT
VSGDVYFGKGVVLKGTVIIIANFGNLINIPPGSILENKIVSGNLRILDH
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgatatctttcaaggagttgtttaagcaatatttacatgataaaacagaaaaatttgat
tggaatatgatggaacctgttccatctgaaagtatcaaaatgtacgatgcccttcatgtt
cctactgatcgtgaagtaattcgtcaacagttaaataagctagtaatggtgaagctaaat
ggtggcttgggcaccacaatgggttgtactggaccaaaatctttaatttcagtccgaagt
aaccttacttttcttgacctgactgtacaacaaatcgagagactaaacaatgaatacgga
actaatattcccttggttctgatgaattccttcaatacacatactgaaactgaaaaggtt
ttacgcaaatatcagcaagttaatgttcaaattttgacatttttacaaagctgctatcct
cgtctgaatcgagagtcattacttcctattgctaaatgtgctggtcaagaaagtcatgac
tctggaacaaagacttctaaagatatgaactataatcctgaagaatggtatcctcctgga
catggtgatttctatcgtagttttgttgcttgtggattagctgagaaaatgatagctatt
ggtaaacaatgggttttcatgtcaaatattgataatcttggggcaactgttgatctaaat
attctaaattttttgatgaataaagaatttcattgtggcaaacaatccccagagtttgtt
atggaagtaactgataaaacacgagctgatgttaaaggtggcacattaacacaatatcgt
ggacatctaagacttttagaattagctcaggtccctgaagaacatgttgatgatttcgct
agtgtacgaacatttaagatatttaatactaataatctttggattgatttacaagctttg
catcgtagtgttaaacaaaaaactctacaaatggaaatcatagtcaatcctaaaacttta
gattccggtacgaatatattacaattggaagaggctgcaggggctgctatcaagtcattt
aatggtgctttcggtgttaatgttccacgaagtcgtttcctaccagttaaaactacttca
gatttattgttagtaatgtctaatttatatgtattagatggtggaagtttatcattgtct
ccattgcgaagtttcccatctgtgcctttagtaaaacttggtagtcattttaaaaaagtc
aaagattttttaagtcgatttacaagtataccagatctactggaattggatcatttaact
gtatccggagatgtatactttggaaaaggagtagttttaaagggtacagttattataatt
gccaattttggtaatctcattaatataccaccaggttcaatattagaaaataaaattgtt
tcaggaaatctacgcattttagatcattaa

DBGET integrated database retrieval system