KEGG   Schistosoma mansoni: Smp_134020Help
Entry
Smp_134020        CDS       T01095                                 

Definition
cell division cycle
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
smm  Schistosoma mansoni
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:smm00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Smp_134020
Protein phosphatases and associated proteins [BR:smm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Smp_134020
Ubiquitin system [BR:smm04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     Smp_134020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 787 aa AA seqDB search
MFACVPVFSKLSENQITSPESILSKAVQLPSSQCLPELQFTLNSLNNSQNDMTSLQIPHQ
RNDTSCNNNTTMGSKKDPHIDEPNANRNATYNVKINTSITSLEKSNALSDTPTSALRHLV
STAASNLGFLTLEPNVTSTTTSLVSTPNARLEPPLLRSTSQRNLYPTPSTRHNRDSLSVL
RSNLQFFNPASQSPGMLTSSSTPRPLSSQQTSTGCRAIESTTSVDISTGGPRTRSQVAAA
AAVARASGIQRKSNRFLRSRGQNRKLDSKLLLSDSTGNSANVQPKITSSGVCPDPSSLKN
IHTSINEGAPDFGCSNHYNAPLSIDAPPITDDPRILSLQQYLNLLSQLGKAYQMLVRHQW
RSATRLLLKLPSSQLHTGRVLAWAARAHMDNSDYQTAHKLFNEARRIEPWQLSGMDFYST
VLWQVQADQELSQLAHDLLQLDRNAPEPWCVAGNCLSLQGEHEAAIKFFRRALQVSPTSA
YAWTLLGHEQSTLEEFDRALAAFQFALRIDPRHYNALFGISNVYYKQEKFDLAENYLVRA
VALFPQSHLLLTHLAALRSRLGRLDDGYGSAMDLISRACKIQPNNPLARYHKASILYHLG
RYSEVLSELQKLLVLTPREAMVYLMIGHTYKKLGNTPQAMIHYSWAMELDPKGANSHLRD
IMTNPPISSRGLNRQDTSEGQNTGNSARPHFSSFQIGVCANFEEEDGNEIIDRASGADEE
MVNSLLHPSQSVTRSNLVRRLTDFSLLYEMEGYEQDPVISDADEEHYDTMDLSGGVDSRT
ERSIPDD
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcttgtgttcccgtattttcaaaactttctgagaatcaaattacatctccagaa
tcgatcctctcgaaagctgtgcagttgccttcaagtcagtgtttaccagagttacagttt
actcttaactcattgaataatagccaaaatgatatgacctctctccaaatccctcatcag
cgaaatgatacttcatgcaacaacaacacaactatggggtccaaaaaggaccctcatatt
gacgaaccgaatgctaatagaaatgctacatataacgtcaaaattaatacatctattacc
tctttagagaaatctaatgctctctccgacacaccaaccagtgctcttcgtcatcttgtc
tccacggcagcatctaatcttggttttttaacgctcgagccaaatgttacttcgactacc
acctctcttgtcagcacaccaaatgcccgtcttgaaccacctcttctacgtagcacttct
caacgcaatttgtatcctacgcccagtacccgccacaaccgtgattctctctcagtattg
agatcaaatttgcagtttttcaatcctgcttctcaaagtcctggcatgttgacttcttct
tcaacaccgagaccactttcaagtcaacaaacatctacggggtgtcgagctatcgaaagc
accacttctgtggacatatctacgggtggacctcgaacaagatcccaggtggcagcagct
gcagctgtagccagagcttctgggattcagagaaagtcgaatagatttttaagaagtcga
ggtcagaaccgcaagttagattctaaattactactatcggactctacaggaaactctgca
aacgtgcaacctaaaataaccagttcaggcgtatgtcccgaccctagttcccttaaaaat
atacatacttctataaatgaaggtgcaccagattttggatgcagcaatcattataatgca
cccttgtcaatcgatgctccacctataacagatgatccgaggatactctcactacagcag
tatttaaacttgttaagtcagcttggtaaagcttatcaaatgttggtgcgacatcagtgg
cgttcagctactcgcctacttttaaaacttccaagctctcaacttcatactggccgtgtt
ttggcgtgggcagctcgcgctcatatggataattcagattatcaaacagctcataagttg
ttcaatgaagctcgtcgtatagaaccatggcagttatctggaatggacttctactcgaca
gtactatggcaagtccaagctgatcaggaattatcacaattagctcatgatttgttacaa
cttgatcgtaatgctcctgaaccttggtgtgttgcaggtaattgtctctctttgcaaggt
gaacatgaagcggctattaaattctttcgccgtgcacttcaggtttcacctacaagtgct
tatgcttggacacttttgggtcatgaacagtcaactctagaagagtttgatcgagcacta
gcagctttccaattcgccttaagaattgatccaagacattataatgctttgttcggcatc
agtaatgtttattacaaacaagaaaagttcgatcttgccgaaaattacttggttcgcgca
gttgcacttttccctcagtcacatttacttttgactcatcttgcagctttacgcagtcga
ctaggtagacttgatgatgggtatgggagcgcaatggatttgattagtcgtgcttgtaaa
attcaacccaacaatcctctggctcgttaccacaaagcatctattttatatcatcttgga
cgttattctgaagtattatcggagcttcaaaaacttttggttttaactccacgtgaggcc
atggtttacttgatgattggtcatacctacaaaaaactggggaatacaccacaagcaatg
attcattactcatgggctatggagcttgatcctaagggtgctaacagtcatctgagagat
ataatgaccaatccaccaatttcaagtcgcggcttgaatcgacaagacacttccgagggc
cagaacacgggcaactcggccagaccacatttcagctcatttcaaattggtgtttgtgct
aacttcgaagaagaggatggaaatgagatcattgatcgggcttcaggagcagacgaagaa
atggttaacagtttacttcatccatcacaaagtgtgactcgttcaaacttagttcgccga
ctgactgatttctcgttactgtatgaaatggaaggatatgaacaggaccctgtaatatct
gatgcagatgaagagcactatgatacgatggatttgagtggtggagttgatagcagaact
gagcgtagcataccagacgattga

DBGET integrated database retrieval system