KEGG   Schistosoma mansoni: Smp_134560Help
Entry
Smp_134560        CDS       T01095                                 

Definition
serine/threonine protein kinase
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
smm  Schistosoma mansoni
Brite
Enzymes [BR:smm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Smp_134560
Protein kinases [BR:smm01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   Smp_134560
Spliceosome [BR:smm03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Smp_134560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 2483 aa AA seqDB search
MPYSSSSHVPLLPSDARHKLQLRKCYNDSAGMGKTDIRRHVRDTEHDTSLRLGIKRRYNS
RGNSNVVNYHSGEQKRIRKSSPGYGYPSAESHNSDEEWNLGINKTVPRKVTSLSRNPLLS
TRPHGYGNRFHGYDPNQAAVPNKFKNYKLDVNNANQNMDNEQLLMLYYSHMYQQYYRTYT
ATALSLSNYPNADLLPAVAAAAANNSGIPSDLTSIGSVLSSGNSFDFSKHSRDVDIRGRR
PKKYHKHESSNVSSRSPEQRQHSHSRTFRSNRTNDSSRSSVKDTVPKGKGFRKRESPVKV
KKTEYTSEESDDHCLDYVSNDQLCEENSADDDNESQQKSSRRVVRRRSTVETTTSTGQKE
ESVHDEDNSKVVTSNTSEIVTESKQSFGANNEVQKTSTSSTSNRVAAEGKRRHVEVLPTD
TLLPMSTEFDHERGPLLPTPVDVDRRHLRFRNAGNDLSLFPGCATAPHIPNVLEAAALMS
GLCPSLFPSMNPSNLLNTLRCPPVDFAPPFCDLFNLPNPIEIQKQINCLKMNCHPPSESS
ESKSGRSKYENSKIRSDVREIRSTFNKHYNMKTRHGNDSESESNCSSGSDYQANVVVRKS
VNRPPSSDRCMLEAPKNKHSGKFSTTRKVKDKMKKEQEPVSDKQEFPRKSNKYMSPDDSP
GPPDTNSNKPVSRVPRGPRTPSSPPLSSQDEGDSGGTCSHYDLSRESCSRSSLNNKTRRQ
NEITSSVSGRCLDSSNSNENLSVRKPVVCTNSQSSNNRSPKTRSSKHNTKIMRGRDHHSS
NCSNSSTSASTSRSNSYEAPNVCNTSNKKKRSTNRHITHSNVGMSYEDNSPNQSSQFAHF
RSDDTGDSSDSSDQQNRALPAAYANPHQSDRHQSHSSGDVEPPPAPSPRSSSSSTSSSSS
SRSYCHIRSSSSNPPENNKIQAISSGSSRHSSTSQSQDRVRHTQSKSRRQGIKPKSKKLN
DSDDHNQQTRSLKEKKKMSTSLCHRSSDSVDDINDNNRREISNPVYSYRDSSSDLKDISS
KESSILRRGEDTRSDVSEDESSTSGGRNMCRQSSRSRSSSYTSSRSTDRNVSNRRNKERV
IENKYKHSKRKPCTPDSSLSNTRKYGQTKNRNEHNIEEKHFNSNRKRALLPPPTSTKPET
KIWRSRKGYVNEVPASSLRHPQLPNSHHSVNKKVFHGQVTSKTSRRSSAMKNQREESSWS
TMAHERHTRDDHYGSGSFKSGTMHIDMTDSSSRPRPPRFGHTTNNKDTHGVRQNYTSRNY
PVKHLHIKTDVHDSKLHWSKSGNTRNFRPPVTSSSRSPIGKVGKHIGASTDHHHHQNARK
KQTDIVWEPGPKSIKKVNNNYSTKVSSSKALLKTPETTSRRADHHYHSQHESSRDSESHN
SDSSNFNHCTLDSTNNLQQQELSSVVHSSPNCKQLPNRTSFNPTSSTEISNFVPKITSVT
SVESSSSSAQPVCLQHLIPNCYLPVAICTSSSNLKESNTRTLIKHTPEYSLYNHSQIKNH
QFHLLEYASNLLHPSHSYILVGLINLTFSEQTFYFTQSVDYHVLIIVTDCIVYHYCKTIK
NSVQSIYLSNPLLLSDYKPNPVINSTENSLNYFTNLSNIQLLTTSNSISILEPYITDSFH
QLTLISNQLGYINSPKANQNLTIMSTSSTRPPRVPANSNLASTVRATGNSHINDGLSRLR
VGSAASRESSYSPPADRKPATTRRTIKPTYGVKADEVNAALLRKLEKATSSFSHPDFEDD
TGGASSDNDVFDTEDDGCAMKHDEGIILLATSSSLLSPESPVYGNEAGAGDLLPTSSSSV
KSPVKQLLKALTSGSRLVTLKPISKRELCQKHVPTANMATQTNDIHLVCERCSNYFSLDT
EQAPSSSTCITNKGDENQQPSLYKLSLFTSVIEYMPYLIPLSRGVPLRRMRSTTTSNNPL
VFGANSLRFRWPIDGEFVDCTETLPDHPAAVFTVCIICDGYTATDVRFTKRVEYFNSPCK
ASVIVCGPFTFKSCSNIKSGNHLRKIDNFNEVTKTKSNNLHNGSMKNSLNSNNEIDEEEN
NKLNDNHEDDEDSECETVGRRLRRQLRRTQKTQEINAATSPEEEDDDEVVDDVDGHLIYS
IGDRLLNRYEIVKTLGEGTFGKVVECKDHVQNRRIALKIIKNVDKYREAAMLEINVLNFL
NERSANVEHLCVTLLDWFDYHGHICLAFDILGLSVFDFLKENNYVGYPMEHVRHISYQLC
YAVRFLHDNQLTHTDLKPENILFVDSDYISVHNRKKRRHERMVKCSDIRLIDFGSATFDY
DHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIMFELYTGYTLFQTHDNREHLAMMER
TLGHIPYRMTRKSRTGFFYHGRLDWDFYNQEGRYVRENCRPLLRYCKDESQDTLDLFDLM
SKMLEYDPADRIPLSAALTHPFFLHLPSHQRLTYTPYPLDTIPPNERRTSGSRSGTTNQQ
PSTTANNGSSSSSSVSSDFKRNR
NT seq 7452 nt NT seq  +upstreamnt  +downstreamnt
atgccttactcatcaagttcacacgttcctctactcccttcagatgcacgccataaattg
cagctcagaaaatgctacaatgactcggcaggtatggggaaaacagatataagacggcat
gtgcgggatactgagcatgatacttctttacgacttggtatcaaacggagatacaactcg
cgtggcaacagtaatgtggtcaactatcattcgggagaacaaaagcgaataagaaagtca
agtcccggttatggctaccctagtgcggaaagtcataattctgatgaagaatggaatctg
ggaattaacaaaactgttcctcggaaagtaactagtttatccaggaatcccttgttaagt
acacgaccacacggttatgggaatcgatttcacggttatgatcccaatcaagccgctgta
cccaacaaattcaaaaactacaaactggatgttaataatgctaatcaaaatatggataat
gagcaacttttaatgttgtattacagtcatatgtatcaacagtactaccgaacttatacg
gcgactgctctctcattgtcaaattatcccaatgctgacttactacctgctgttgcagct
gcagctgctaacaattcaggtattccatcggatttaacttctataggatcagtactatca
agtggtaatagttttgatttctccaaacatagtcgagatgtggatatacgtggaaggcgt
ccaaaaaaatatcataagcatgagtcatccaatgtttcttcccgttcacctgaacaacgt
caacactcacattctcgtacttttcgatctaatagaacaaacgactcttctcgttcctct
gtgaaagatacagttccaaaagggaaaggatttagaaaaagagaatcacctgttaaagta
aaaaagacagaatacacttctgaagaaagtgatgaccattgcctagattacgttagtaat
gatcaactttgtgaagagaattcagcagatgatgataatgaaagtcaacagaaatcttcc
agacgcgttgttcgtagacgctcgactgttgaaactactacgtcaaccggacagaaagag
gagtccgttcatgacgaagataattccaaagtcgtaacatcaaatacgtctgaaattgtt
actgagtccaaacaatcattcggagctaataatgaagtacagaaaacgtctacatcctcg
acgtctaaccgagttgcggcagaaggtaaaagacggcatgttgaagtcctgcctactgac
actttacttcctatgtccactgagttcgatcatgaacgtggaccacttttacctacacca
gtggatgtggatagacgacacttgagatttcgtaacgctggcaacgatttatcattattc
cctggctgtgctacagcacctcatattccgaatgtcttggaagctgctgcactaatgtca
ggtctttgcccatctctatttccgtctatgaatccatcgaatttgttaaatactctaaga
tgtcctcctgttgatttcgctccaccattttgtgatctatttaatttaccgaatccgatt
gaaattcagaaacaaataaattgtttaaagatgaactgtcatcccccatctgagtcatca
gaatctaagtctggacgaagtaaatatgaaaactccaaaataagaagtgatgtcagggaa
attcgttccacgtttaataaacattacaatatgaaaacccgacatgggaatgactcggaa
tctgaaagtaattgttcttctggttcagattatcaagctaatgttgtagtacgcaaatct
gttaatagaccaccatcttcagatagatgcatgttagaagccccaaagaacaagcattca
ggaaaattttcaacaacacgtaaagtgaaagataaaatgaaaaaagaacaggaaccagta
tcagataaacaagaattcccccgtaaaagtaacaaatatatgtctcctgatgattcacct
gggccgccagatacaaattctaataaaccagtctcgcgtgtcccacgaggtccaagaaca
ccatctagtccaccgttatcttctcaggatgaaggtgattctggtggtacatgttcacat
tatgatttatcccgtgaatcttgctccagaagttctcttaataataagacacgtcgacaa
aacgaaataactagttccgtatcaggtcgctgtttggattcatcgaattcaaatgaaaat
ctatctgtaagaaaacctgttgtgtgtacaaattctcaatcgtcaaataacagatcgccg
aagacacgctcctcaaagcataatactaaaataatgcgtggtcgagatcaccacagctcc
aactgttccaactcatccacttcggcgtctacttctcggtcaaattcttatgaagctcca
aatgtctgtaatacttccaataaaaaaaagaggtctacaaatcgacatattacacattcc
aatgtaggcatgtcctacgaagataattcccctaaccaatcttcacagtttgcacatttt
cgtagcgatgatactggtgatagtagtgacagctcagatcaacaaaaccgtgcattacct
gcagcctatgcaaatcctcatcaaagcgaccgacatcagtcacactcatctggtgatgtt
gaacctccgcctgctccttctcctcgtagttcatcttcttccacttcctcttcatcatca
tctcgttcatattgtcacattcgttcaagttcaagtaatcctccagaaaataacaagatt
caagcaatatcatctggttcttcacgtcattcgtcaacatctcaatcacaagacagagtt
agacatactcaatcgaagtcacgacggcaaggtattaaaccgaaatcaaaaaaactaaat
gatagtgatgatcacaatcaacaaacccgctctttaaaagaaaagaaaaaaatgtctaca
tccttgtgtcatagaagctctgattctgttgatgatattaatgacaacaatagaagagaa
atatcgaatccggtttatagttaccgtgattcttcatcagatcttaaagatatttcttct
aaagagtcatccattttgagacgcggagaagatactcgttctgacgtttctgaggatgag
agctcaacgtcaggtggtcgaaatatgtgtagacagtcctctcgttctcgaagttcttct
tacacttcttcaagaagtactgatcgtaatgtgtcaaatcgtagaaacaaagaaagagtg
atagaaaacaaatacaaacattccaagcgaaagccatgtactcctgattcatcattatcg
aatactcgcaaatatggacaaactaaaaaccgaaatgaacataatattgaagaaaagcat
tttaatagcaaccgtaaacgtgctttacttcctccaccgacgagtacaaaacctgaaact
aaaatatggagatcaaggaaaggttatgtcaatgaagttcccgcttcatctttacgacat
ccgcagcttccaaactcccatcactcagtgaataagaaagtttttcatggacaagtcaca
tcgaaaacatccaggcgttcgagtgctatgaaaaatcaacgagaagaaagttcttggtca
acaatggctcatgaacgtcacactcgcgatgatcattatggtagtggatcatttaaatcc
ggaactatgcatattgatatgactgatagctcatctcgaccgagaccacctcgttttgga
catacaaccaataacaaggatactcatggtgtgcgacaaaattacacctctaggaattat
cctgtaaaacatttacacattaaaacagatgtgcatgactcaaaattacattggtctaaa
agtggcaacacgagaaattttcgcccaccagttacctcttcaagtcgatcacctattggt
aaagttggaaaacatattggagcatcaactgatcatcatcatcaccagaatgcacgtaag
aaacaaacagatattgtatgggagcctggtcctaaaagtattaaaaaggtgaataataat
tattcaactaaagtttccagctctaaagcacttttaaaaacacctgaaacaacttcacgg
cgtgcagatcatcattatcatagtcaacatgagtcgtctagagactctgaatcgcataat
tctgattcttcaaattttaatcattgtacattagattctacaaataatttacaacaacaa
gagttatcatcagtagttcattcatcacctaattgtaaacagttaccaaatcgtacaagt
tttaatcctacttcttcaactgaaatttctaattttgtgccaaaaataacttcagtcact
tctgtagaatcttccagtagttctgctcaacctgtttgtttacaacatttaataccaaat
tgttatcttcctgttgctatttgtacatcatcttcaaatttaaaagagagcaacaccagg
acactaatcaaacatacacctgaatactctttgtataatcattcacaaatcaaaaatcat
caattccatttattggaatatgcatcaaacttattgcatccctctcattcatatatacta
gttggactgataaatttaacattttctgagcaaactttttattttacacaatcagtggat
tatcatgttttgattatagttacagattgtatagtttatcattattgtaaaacaattaaa
aatagtgttcagtctatttatttatctaatccacttttattgtctgattataaaccaaat
cctgtgataaactccacagaaaattcattaaactatttcactaacttatcaaatattcaa
ttattaacaacatcaaattcaatttctatattggaaccttacataactgattcttttcat
cagttgacattgatctctaatcaattaggttacattaattctcccaaagctaatcaaaat
ttaacaattatgtctacttcatctactcggccgccaagagttcctgcgaattcaaattta
gcatctacagttcgtgctactggtaatagtcatattaatgatggtttaagtcgattacgt
gtaggaagcgcagcgtctagagagtcttcttattctccaccagctgataggaaacctgca
actacacgacgcacaatcaaacctacatatggtgttaaagctgatgaggtgaatgcagcg
ctactacgtaaacttgaaaaagctacctctagttttagtcatccagattttgaagatgat
actggtggagcttcctcagacaatgatgtatttgatacagaagatgatggatgtgcaatg
aaacatgatgaaggtattattttgctggccacttcatcatctctgttgtctccagaatca
ccagtttatggaaatgaagctggtgctggagatctattacctacatcatcttcttcagtc
aaatctcctgtaaaacaattacttaaggcacttacttctggcagtcgattggttacatta
aagccaatttcaaagcgtgaactatgtcaaaaacatgttccaacagcaaatatggccact
cagacaaatgatatccatcttgtttgtgaacgatgttcaaactatttctcgttggataca
gaacaggctccttcatcatctacttgtataactaataagggagatgaaaatcaacagcca
tctttgtataaactcagtttattcactagtgttattgaatatatgccttatctaatacca
ttatctcgtggtgttccattaagacgtatgcggtctactacaactagtaacaatccatta
gttttcggtgctaattcgctcagatttcgttggccaatagatggtgaattcgtggattgt
actgaaactttaccggatcatcctgcagctgtattcactgtttgcattatttgtgatggg
tatactgcaacagatgttagatttactaagagagtagaatatttcaattctccatgcaaa
gcatcagttattgtttgtggtccatttactttcaagtcatgttctaacataaagtcaggc
aatcatttaagaaagatagataatttcaatgaagtaactaaaactaaaagtaataactta
cacaatggatcaatgaaaaattctttgaattccaacaatgaaattgatgaagaagaaaat
aacaaactaaatgacaatcatgaagatgacgaggattccgagtgtgaaacagttggtcga
cgtcttcgacgacaacttcgtcgtacacaaaaaacacaagagataaatgcagctacttct
cctgaagaagaagacgatgatgaagtcgtggatgatgttgacggtcatctgatctatagt
attggtgatcgtttgttgaatcgatatgaaattgtgaagacacttggagaaggtacattt
ggtaaagttgttgaatgtaaagatcatgtacaaaatcgtagaattgctttgaaaattatc
aaaaatgttgataaatatcgtgaagctgctatgcttgaaatcaatgttttaaatttctta
aatgaacgtagtgcaaatgttgaacatttatgtgtaacattgttggattggtttgattat
catggacatatctgtttggcatttgatatacttggattatctgtttttgatttcttgaaa
gaaaataattatgttggttatccaatggaacatgttcgtcatatatcatatcaattatgt
tatgctgtacgatttttacatgataatcaattaactcatacagatttaaaaccagaaaat
atattatttgttgattccgattatatatcagtccataatcgtaaaaaacgtcgacatgaa
cgtatggttaaatgttctgatatacgtttaattgattttggttcagcaacatttgattat
gatcatcattctacaattgtatcaacaagacattatcgtgcacctgaagtaatactggaa
ttaggttggtctcaaccatgtgatgtttggtcaattggatgcattatgtttgaattgtat
acaggttatacacttttccagactcatgataaccgtgaacatttagctatgatggaacgt
actttaggtcatattccttatcgaatgaccagaaagtcacgaactgggtttttctatcat
ggacgtttggactgggatttttataatcaagaaggtcgttatgttcgtgagaattgtcgt
cctttacttcgttattgcaaagatgaaagtcaagatacacttgatctatttgacttaatg
tctaaaatgttagaatatgatccagcagatcgtattccattgtctgcagcacttacacat
ccattctttttacatttaccatcgcatcaacgtttaacatatactccttatccattggat
acaattccacctaatgaacgtcgtacatctggttcacgtagtggaacaactaatcaacaa
ccatcaacaacagcgaataatggctcatcatcttcatcatcagtatcatcagattttaaa
cgtaatcggtaa

DBGET integrated database retrieval system