KEGG   Schistosoma mansoni: Smp_134590Help
Entry
Smp_134590        CDS       T01095                                 

Definition
(RefSeq) putative unc-13 (munc13)
  KO
K15293  
protein unc-13 A/B/C
Organism
smm  Schistosoma mansoni
Brite
Membrane trafficking [BR:smm04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    Smp_134590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
GeneDB: 
Position
7
AA seq 2128 aa AA seqDB search
MSNYPVYHPILPNQSEWDPASEVERIMCGTRQQEYPVITSGSHTLPRHYQLRETNLITFR
YRAMNGGECSTINRYDKNIQHANKMYPWGSPTTSVRQFTTTFHPSYQTSVGYDPSALFSS
SPSSVRSDEQLYYRQQRLVKPVNQSRYVLSTNNTFSTAITTNSTTTTTVAYPHNRNTMNN
HIMYNTLQLTGHVNQLPVQQTPINHLNNTTRLQYPSALVRTIVRMESSGSQQPQQQQQQQ
PADIPPALPLRAQRSTNQKVTVPTKPRHLIPIPLEDRVHLDPNMVLYKPNAGINNHNNFD
DNLSQSISVQLNHKRNTFDLESHLDCSCDYVRGEAGLWPADVWFERNFHTVDKCTCPHEE
VHRFFDNAPSKWKLADTIAMLPIRETDILDDLIDSTSDEDESFHRSLPSVMMESPADTIS
KIKIVTTNYNDLNVTSTPLLNIPMSSNLNHVQSDVQKDKSTYKTSITCHNLVTNNTSSNI
SCDEDDLVPLGELLSSNTNLLRTISNLDKPEFSVGETTVRLTPASSRKQSLLCLKEDEDE
RNTSISRRNSSQFMEQREHIPGVTKGVVSTVAISSVPNDTHCLDVIATNTSRRKSPPGET
SSQLWKAQIAEREDNIPKNRAKSIYRQSGDGHLTGKSYINTEGTHTEDVLILNNLTDPGR
NDMERSIQDMIGENKTEQQKEERKQSLSPSVNRFLEPDGCVYTENKENAFQIDNVAEALD
RLHQDMRSAIESKLVDNSSSSTMNKEGSLTICPKMESCSNLLDRQNKHLYTKYDWRDENR
EFSQNKENHLIHDIELMGEDNNTEHDQEIDVDHYFLQPRRSTLKLDDNDLSVIRYPVSHK
STGNNYIGHVPSDNREFNDKTQNVIDNDEENDVGVHYYEDDRNSMVEENEELNQSMEYKF
NDELTDPSLSKKSGQTIRVNKYGRAKERWSLLRTHVGKVGRQKAEDSDSTSAFGFYRSIE
SQPEQQPWAKKAIPMVGDLTMAQKRTLTSLSSNLASWTLTDQELKMHVYRKTLQALAYPI
SSNTPHNFQLFSATSPTYCYECEGLLWGVARQGLRCTECGVKCHDKCKRLLNADCLQRAA
EKSLRHGAVDKAQAAMEAIRALIQRRITERSDIFEFLANVFQIDVHSMTHLNALEFAQKS
IVAGASQWSAKIAITVKSAQGLIGKDKTGRSDPYVTVQVGKVRKRTKTVLQELNPTWDEK
FLFECDNALERIKLRVWDEDNDLKSKIRQKFTRESDDFLGQTIIEVRTLSGEMDVWYNLE
KRTDKSAVSGAIRLLISVEIKGEEQMASFHVQYTALHGGNEAWRVYFNPIGQEIVDEFAI
RYGIEPIFQAMTHFACLTAKYNYPGVPAQLSVLLANINAFYAHTTSSNSQTASERFSASN
FGREKFIKLLDNLYIAIRIDLSKYRTVFPASQPERLIDLKSTVDLLTSITFFRLKVQELS
SPPRTGQILRECIEACIHATYQCLCENVHDLYGKKSGNAEFVSDNMNSGTGQSLIGELDQ
VDGIRSLTYWHRLITLVVSVLEDDRKHYAPVLNQFPHEINLGDMSAEMIWKCLSEDLANG
LVQHTITAKYYFNNTEEDILDSLSKVNKLHDSSQSTGQNKVVLKSGMNKIKSSDYMNLCF
RVKWFYNTYIATLARFKNSVPDYPRWFEGLVLIWLAENDEVSANYLRNAYDRDKQDGFQC
SSEHVLYSNSVVDVFTQLNQCFDVIRKLECPDKQVEGHFFHRFSLTVEKVLLAYADRVLA
DFPTYKTDQRVACILVNNTQQLRVQLEKVYENMARESLESNTRDRLSALQGRLNEVVDKL
AIQLTDQFEAGVRSHARECGKLLQKCRPSNSSDNTTGRGVSKEDEANECLQPLMDHFESI
LSILANVCDKTVLKRILKQLWRITMCNLEKLVVLPTVTDQKQETTREPEKGLTPYQCELL
GICLNNNSCIFSCWWTWCETFEPVGYLTLQVEIFKHPGTGEYKVNVKIHTASDLNWSLAT
GMFRPFVEVYIFGPLLSDRKRKAATKSKSVTTMPIYHETFVFFLSNQSDPEWYELHLSVK
DYCFGRTDRLVGVTVLSLSRALNLGATPIRLPLGRRLHFTETGWTVLRVLSQRVNTDDVA
REFVRAKSEYRAPTENDNTGLLTQQNGE
NT seq 6387 nt NT seq  +upstreamnt  +downstreamnt
atgtctaactatcctgtttaccatccgatactgcctaatcaatcagaatgggatcctgct
agtgaagtggaacgtattatgtgtggaactagacaacaagagtaccctgtgattacgagt
ggatcacacacactacctcgtcattatcaattacgtgaaacaaatctaatcacatttaga
tatcgtgctatgaatggaggtgagtgtagtacaataaacagatatgataaaaacattcaa
catgctaataaaatgtatccatggggatctccaacaacaagtgtcagacaatttacaaca
acatttcatccatcttaccaaacttctgtaggttatgatccatctgcactattttcatca
tcaccttcgtcagttcgctctgatgaacaactgtattatagacaacaacgattagtaaag
cccgtaaatcaatcaaggtacgtattgagtaccaacaatacattctctactgctatcact
actaatagtactactactactactgttgcttatccacataataggaatacaatgaacaat
catattatgtataatacattgcaactaactggacatgttaaccaactccctgttcaacaa
acaccaataaatcatctaaataatacaacacgcctacaatatccatcagctttagtacga
acaattgttagaatggaatcgtcgggttctcaacaaccacagcaacaacaacaacaacag
ccagctgatataccaccggctttaccattaagagctcaacgttctacaaatcaaaaagta
acagtacctactaaaccacgtcacttaattcctatcccattggaagatcgtgtacattta
gatccaaatatggtattgtataaacctaatgctggaattaataatcataataattttgat
gataacctatcacaatcaatctcagttcaattaaatcataaaagaaatacatttgatcta
gaaagtcatttagactgttcatgtgattatgtacgaggtgaagctggcttgtggccagct
gatgtatggtttgaacgcaattttcataccgttgataaatgtacgtgcccacatgaagaa
gtacatcgattttttgataatgcaccttcaaaatggaaattagccgatactattgccatg
ctaccaataagagaaactgatattttagacgatttaattgatagtacaagcgatgaagat
gagtcatttcatcgttcactaccatcagttatgatggagtcaccagcagacacaatttct
aaaataaaaatcgtaacaacaaactataatgatttaaatgtgacttccacaccattactc
aacattccgatgtctagtaatcttaatcatgtacagtcggatgtgcaaaaagataaatca
acctataagactagtatcacatgtcataatcttgttacaaataacactagtagtaatatt
tcttgcgatgaagatgacttagtccctctgggtgaactattgtcgtcaaatacaaactta
ctaagaacaatttcaaatttggacaaaccagaattttctgttggtgagaccacagtaaga
ttgacacctgcatcgtcaagaaaacaaagcttactctgccttaaagaagacgaagacgag
agaaatacaagtatctctaggagaaacagttctcaatttatggaacaaagagaacatatt
cctggtgtaacgaaaggggttgtttcaactgttgcaatatccagtgtacctaatgatacg
cattgtttagatgttatcgccactaatactagtcgacgtaaatcaccacctggagaaaca
tcttcacagctgtggaaggcacagatcgctgaacgtgaagataatattcccaaaaaccgt
gcaaaatcaatatatcgtcagtctggagatggccatttgacaggaaaaagttatattaac
acagaaggcacacacacagaggacgtgctaatactaaataatttaactgatcctggtcga
aatgatatggaaagaagcatccaagatatgattggtgagaataaaacggaacaacaaaaa
gaggaacgaaaacagtctctctctccttctgtgaatcgatttctggaaccagatggttgt
gtctatacagaaaataaagagaatgcatttcagatcgataatgttgcagaagccctagat
cgattacatcaggatatgagaagtgcgatagaaagtaaattagtagataattcatcatcg
tctacaatgaacaaggaaggatcattaacaatttgccctaaaatggaatcgtgctcaaac
ctgttagatagacaaaacaagcatctatacactaaatatgactggagagatgagaatagg
gaattcagccagaataaagaaaatcatttaatccatgatattgaattaatgggggaagac
aacaatacagaacatgatcaagagattgatgtggatcattacttcctccagcctagaagg
tccactttaaaactggatgacaatgatttatcagtgatacgttatccagtttctcataaa
tccaccggcaataattatattggtcatgttccttctgataatcgggagtttaatgacaaa
actcaaaatgttattgataatgatgaagagaacgatgtgggggtacattattatgaagat
gatcgtaattcgatggtggaggaaaatgaggaactaaatcaaagtatggaatataaattc
aacgatgaattgaccgatcctagtttatcaaaaaagtctggacagactataagggtcaat
aaatatggaagagctaaggaacgatggagtcttcttcgtacgcatgttggaaaggttggc
aggcagaaagcagaagacagtgattcaacttccgcatttggattttatcgatctatcgaa
agtcaacctgagcaacaaccatgggctaagaaagcaattccaatggttggtgatttgaca
atggcacagaaacgtacattaacatctttgtcgtctaatctagccagttggacactgaca
gaccaagaattgaaaatgcatgtttatcgtaaaacattacaagccttggcttatcccata
tcaagtaacacaccgcataattttcaattgtttagtgctacaagtcctacttattgttat
gaatgtgaaggcttattatggggtgtagccaggcaaggattacgatgtactgaatgtggt
gtcaaatgtcatgataaatgtaaacgtttattaaatgcagattgtttacaaagagctgca
gaaaaatctttacgtcatggtgctgtagataaagctcaagctgcaatggaagcaatacgt
gcgctgattcaacgacgtataactgaacgatcagatatttttgaatttttagccaatgtt
tttcaaattgatgttcattcaatgacacatttaaacgctttagaatttgcacaaaaaagt
attgtagccggtgcaagtcaatggtcagctaaaattgcaataaccgtgaaatctgctcag
ggattaattggtaaagataaaactggacgaagtgatccatatgtaacagtacaagttggt
aaagtacgtaaacgtactaaaacagttctacaagaattgaatccaacatgggatgaaaaa
tttctgtttgagtgtgataatgctttggagcgaattaaacttcgtgtttgggatgaagat
aatgatttaaagtcgaaaatccgacaaaaattcaccagagaatcggatgattttcttggt
cagacaattattgaagtaagaacattaagcggtgaaatggatgtatggtataatcttgag
aaacggacagataaatcagcagtatctggagctattcgtttactgatttctgttgaaata
aaaggtgaagaacaaatggcttcatttcatgtacagtatacagcattacatggtggcaat
gaagcatggcgagtgtatttcaatccaataggacaggaaatcgtcgatgaatttgctata
cgttatggtattgaaccaatatttcaagcaatgacacattttgcatgtttaactgctaaa
tacaactatcctggagtaccagctcaattatctgtacttttggctaatataaatgcattt
tacgcacatacaacatcatcaaatagtcagacagctagtgaacgattcagtgcaagcaat
tttggaagagagaaattcattaaattattggacaatttatacatcgccataagaattgat
ctgtcaaaatatcgtactgtatttcctgcatcacaaccagaaagattgattgatttgaaa
tctaccgtagatcttcttacaagtatcacatttttccgtctcaaagttcaagagcttagt
tcacctccaagaacaggtcaaatattacgtgaatgtattgaagcttgtatccatgcaact
tatcagtgcctttgtgaaaatgtacatgatttatatgggaaaaaatctggaaatgctgaa
tttgtatctgataatatgaatagtggtactggacaatcgttaattggggaattagatcaa
gtggatggtatacgatcattgacctattggcatcgtcttatcacattggttgtttcagtt
cttgaagatgatcgaaaacattatgcaccagtattaaatcaatttccacatgaaatcaat
ctaggtgatatgtcagctgagatgatatggaaatgtttatcagaagatttagctaatgga
ttagttcagcatacaattacagcgaaatattattttaataatactgaagaggatatattg
gatagtttatcaaaagtgaataaattacatgattcatctcagtcaactggacaaaataaa
gttgtcttaaaaagtggaatgaataaaatcaaatcttccgactatatgaatctttgtttt
cgagtaaaatggttttataatacttatatagcaacactggcaagattcaaaaattcagtt
cctgattatcctcgttggtttgaaggtctcgtattgatttggttagctgagaatgatgaa
gtatctgcaaattatttaagaaatgcttatgatcgtgacaaacaagatggttttcaatgt
tccagtgaacatgtgctctattcaaattctgttgttgatgtattcactcaactaaatcaa
tgtttcgatgttatacgtaaacttgaatgtccagataaacaagttgaaggacactttttc
catagattctcactaactgttgaaaaagttctccttgcttatgctgatcgtgtgttagct
gatttcccaacatataaaacggatcaacgtgtagcttgtatattagtaaataatacacaa
caacttcgtgttcaactagaaaaagtttatgagaatatggcacgtgaaagtcttgaatcc
aacactcgagatcgtttaagtgctcttcaaggtcgattaaatgaagtagttgataaacta
gctatccaactaactgatcagtttgaagccggggtgcgctcacatgcacgtgaatgtggt
aaacttttacagaagtgtagaccatcgaatagctcggataatacaactggtcgtggtgtc
agtaaagaagatgaagcaaacgaatgcttacaaccgctaatggatcattttgaaagtatt
ttatctatactagcgaatgtctgtgataaaactgtattgaaaagaatattaaagcaatta
tggaggataacaatgtgtaatttagaaaaacttgttgtactacccacagttactgatcag
aaacaggaaacaacacgtgaacctgagaaaggtcttacaccatatcaatgtgaattactt
ggcatttgcttgaataacaattcgtgtatattttcatgctggtggacgtggtgtgaaacg
ttcgagccagttggttacttaacacttcaagtagaaattttcaaacaccctggtaccggt
gaatataaagtaaatgtgaaaattcatacagcttcagatttgaattggtctcttgccact
ggaatgtttaggccatttgtagaagtttatatttttggaccgttattatctgatcgtaaa
cgtaaagctgctacaaaatcgaaatcagtcactacaatgcccatttatcatgaaacattt
gtatttttcttatctaatcaaagtgatcctgaatggtatgaattacatttatctgtaaaa
gattattgttttggacgaactgatcgtcttgttggtgttacagtattatctttatctaga
gcattaaatcttggtgcaactccaattcgacttccattaggacgacgtttacattttaca
gaaactggatggacagtattacgtgtactttcacaacgtgttaatacagatgatgtagct
cgagagtttgttcgtgctaaatcggaatatcgtgctccaacagagaatgataatactgga
ttattaacacaacaaaatggagaataa

DBGET integrated database retrieval system