KEGG   Schistosoma mansoni: Smp_134590Help
Entry
Smp_134590        CDS       T01095                                 

Definition
unc-13 (munc13)
Orthology
K15293  
protein unc-13
Organism
smm  Schistosoma mansoni
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 2313 aa AA seqDB search
MSNYPVYHPILPNQSEWDPASEVERIMCGTRQQEYPVITSGSHTLPRHYQLRETNLITFR
YRAMNGADIPPALPLRAQRSTNQKVTVPTKPRHLIPIPLEDRVHLDPNMVLYKPNAGINN
HNNFDDNLSQSISVQLNHKRNTFDLESHLDCSCDYVRGEAGLWPADVWFERNFHTVDKCT
CPHEEVHRFFDNAPSKWKLADTIAMLPIRETDILDDLIDSTSDEDESFHRSLPSVMMESP
ADTISKIKIVTTNYNDLNVTSTPLLNIPMSSNLNHVQSDVQKDKSTYKTSITCHNLVTNN
TSSNISCDEDDLVPLGELLSSNTNLLRTISNLDKPEFSVGETTVRLTPASSRKQSLLCLK
EDEDERNTSISRRNSSQFMEQREHIPGVTKGVVSTVAISSVPNDTHCLDVIATNTSRRKS
PPGETSSQLWKAQIAEREDNIPKNRAKSIYRQSGDGHLTGKSYINTEGTHTEDVLILNNL
TDPGRNDMERSIQDMIGENKTEQQKEERKQSLSPSVNRFLEPDGCVYTENKENAFQIDNV
AEALDRLHQDMRSAIESKLVDNSSSSTMNKEGSLTICPKMESCSNLLDRQNKHLYTKYDW
RDENREFSQNKENHLIHDIELMGEDNNTEHDQEIDVDHYFLQPRRSTLKLDDNDLSVIRY
PVSHKSTGNNYIGHVPSDNREFNDKTQNVIDNDEENDVGVHYYEDDRNSMVEENEELNQS
MEYKFNDELTDPSLSKKSGQTIRVNKYGRAKERWSLLRTHVGKVGRQKAEDSDSTSAFGF
YRSIESQPEQQPWAKKAIPMVGDLTMAQKRTLTSLSSNLASWTLTDQELKMHVYRKTLQA
LAYPISSNTPHNFQLFSATSPTYCYECEGLLWGVARQGLRCTECGVKCHDKCKRLLNADC
LQRAAEKSLRHGAVDKAQAAMEAIRALIQRRITERSDIFEFLANVFQIDVHSMTHLNALE
FAQKSIVAGASQWSAKIAITVKSAQGLIGKDKTGRSDPYVTVQVGKVRKRTKTVLQELNP
TWDEKFLFECDNALERIKLRVWDEDNDLKSKIRQKFTRESDDFLGQTIIEVRTLSGEMDV
WYNLEKRTDKSAVSGAIRLLISVEIKGEEQMASFHVQYTALHGGNEAWRVYFNPIGQEIV
DEFAIRYGIEPIFQAMTHFACLTAKYNYPGVPAQLSVLLANINAFYAHTTSSNSQTASER
FSASNFGREKFIKLLDNLYIAIRIDLSKYRTVFPASQPERLIDLKSTVDLLTSITFFRLK
VQELSSPPRTGQILRECIEACIHATYQCLCENVHDLYGKKSGNAEFVSDNMNSGTGQSLI
GELDQVDGIRSLTYWHRLITLVVSVLEDDRKHYAPVLNQFPHEINLGDMSAEMIWKCLSE
DLANGLVQHTITAKYYFNNTEEDILDSLSKVNKLHDSSQSTGQNKVVLKSGMNKIKSSDY
MNLCFRVKWFYNTYIATLARFKNSVPDYPRWFEGLVLIWLAENDEVSANYLRNAYDRDKQ
DGFQCSSEHVLYSNSVVDVFTQLNQCFDVIRKLECPDKQVEGHFFHRFSLTVEKVLLAYA
DRVLADFPTYKTDQRVACILVNNTQQLRVQLEKVYENMARESLESNTRDRLSALQGRLNE
VVDKLAIQLTDQFEAGVRSHARECGKLLQKCRPSNSSDNTTGRGVSKEDEANECLQPLMD
HFESILSILANVCDKTVLKRILKQLWRITMCNLEKLVVLPTVTDQKQETTREPEKGLTPY
QCELLGICLNTIRVYFHAGGRGVKRSFLDRSQELHSLRQVLALYSQATDELLRDFIATQT
SQDYLANEEPVGYLTLQVEIFKHPGTGEYKVNVKIHTASDLNWSLATGMFRPFVEVYIFG
PLLSDRKRKAATKSKSVTTMPIYHETFVFFLSNQSDPEWYELHLSVKDYCFGRTDRLVGV
TVLSLSRALNLGATPIRLPLGRRLHFTETGWTVLRVLSQRVNTDDVAREKSSSTTIKTVA
LIPGDGIGPEISAAVQEIFKFADVPIKWESVDVTPRPTEDGRFRMPQSSLDIIRKHGIGL
KGPLATPIGKGHQSLNLALRKEFNLYANVRPCKSIEGYETPYKNVDLVTVRENTEGEYSG
IEHVIVDGVVQSIKLITEEASRRVARFAFQYAKDNGRRSVTAVHKANIMRMSDGLFLRVC
REEAAHHREIEFCDMFLDTVCLNLVQDPTRFDVLVMPNLYGDILSDLAAGLIGGLGVTPS
GNIGETGAIFESVHGTAPDIAGQDRANPTALLFSAIMMLRYMNLNKHADLIESAVLATIR
EAKYLTADLGGRSTCSQYTKEICRQIEQKASNR
NT seq 6942 nt NT seq  +upstreamnt  +downstreamnt
atgtctaactatcctgtttaccatccgatactgcctaatcaatcagaatgggatcctgct
agtgaagtggaacgtattatgtgtggaactagacaacaagagtaccctgtgattacgagt
ggatcacacacactacctcgtcattatcaattacgtgaaacaaatctaatcacatttaga
tatcgtgctatgaatggagctgatataccaccggctttaccattaagagctcaacgttct
acaaatcaaaaagtaacagtacctactaaaccacgtcacttaattcctatcccattggaa
gatcgtgtacatttagatccaaatatggtattgtataaacctaatgctggaattaataat
cataataattttgatgataacctatcacaatcaatctcagttcaattaaatcataaaaga
aatacatttgatctagaaagtcatttagactgttcatgtgattatgtacgaggtgaagct
ggcttgtggccagctgatgtatggtttgaacgcaattttcataccgttgataaatgtacg
tgcccacatgaagaagtacatcgattttttgataatgcaccttcaaaatggaaattagcc
gatactattgccatgctaccaataagagaaactgatattttagacgatttaattgatagt
acaagcgatgaagatgagtcatttcatcgttcactaccatcagttatgatggagtcacca
gcagacacaatttctaaaataaaaatcgtaacaacaaactataatgatttaaatgtgact
tccacaccattactcaacattccgatgtctagtaatcttaatcatgtacagtcggatgtg
caaaaagataaatcaacctataagactagtatcacatgtcataatcttgttacaaataac
actagtagtaatatttcttgcgatgaagatgacttagtccctctgggtgaactattgtcg
tcaaatacaaacttactaagaacaatttcaaatttggacaaaccagaattttctgttggt
gagaccacagtaagattgacacctgcatcgtcaagaaaacaaagcttactctgccttaaa
gaagacgaagacgagagaaatacaagtatctctaggagaaacagttctcaatttatggaa
caaagagaacatattcctggtgtaacgaaaggggttgtttcaactgttgcaatatccagt
gtacctaatgatacgcattgtttagatgttatcgccactaatactagtcgacgtaaatca
ccacctggagaaacatcttcacagctgtggaaggcacagatcgctgaacgtgaagataat
attcccaaaaaccgtgcaaaatcaatatatcgtcagtctggagatggccatttgacagga
aaaagttatattaacacagaaggcacacacacagaggacgtgctaatactaaataattta
actgatcctggtcgaaatgatatggaaagaagcatccaagatatgattggtgagaataaa
acggaacaacaaaaagaggaacgaaaacagtctctctctccttctgtgaatcgatttctg
gaaccagatggttgtgtctatacagaaaataaagagaatgcatttcagatcgataatgtt
gcagaagccctagatcgattacatcaggatatgagaagtgcgatagaaagtaaattagta
gataattcatcatcgtctacaatgaacaaggaaggatcattaacaatttgccctaaaatg
gaatcgtgctcaaacctgttagatagacaaaacaagcatctatacactaaatatgactgg
agagatgagaatagggaattcagccagaataaagaaaatcatttaatccatgatattgaa
ttaatgggggaagacaacaatacagaacatgatcaagagattgatgtggatcattacttc
ctccagcctagaaggtccactttaaaactggatgacaatgatttatcagtgatacgttat
ccagtttctcataaatccaccggcaataattatattggtcatgttccttctgataatcgg
gagtttaatgacaaaactcaaaatgttattgataatgatgaagagaacgatgtgggggta
cattattatgaagatgatcgtaattcgatggtggaggaaaatgaggaactaaatcaaagt
atggaatataaattcaacgatgaattgaccgatcctagtttatcaaaaaagtctggacag
actataagggtcaataaatatggaagagctaaggaacgatggagtcttcttcgtacgcat
gttggaaaggttggcaggcagaaagcagaagacagtgattcaacttccgcatttggattt
tatcgatctatcgaaagtcaacctgagcaacaaccatgggctaagaaagcaattccaatg
gttggtgatttgacaatggcacagaaacgtacattaacatctttgtcgtctaatctagcc
agttggacactgacagaccaagaattgaaaatgcatgtttatcgtaaaacattacaagcc
ttggcttatcccatatcaagtaacacaccgcataattttcaattgtttagtgctacaagt
cctacttattgttatgaatgtgaaggcttattatggggtgtagccaggcaaggattacga
tgtactgaatgtggtgtcaaatgtcatgataaatgtaaacgtttattaaatgcagattgt
ttacaaagagctgcagaaaaatctttacgtcatggtgctgtagataaagctcaagctgca
atggaagcaatacgtgcgctgattcaacgacgtataactgaacgatcagatatttttgaa
tttttagccaatgtttttcaaattgatgttcattcaatgacacatttaaacgctttagaa
tttgcacaaaaaagtattgtagccggtgcaagtcaatggtcagctaaaattgcaataacc
gtgaaatctgctcagggattaattggtaaagataaaactggacgaagtgatccatatgta
acagtacaagttggtaaagtacgtaaacgtactaaaacagttctacaagaattgaatcca
acatgggatgaaaaatttctgtttgagtgtgataatgctttggagcgaattaaacttcgt
gtttgggatgaagataatgatttaaagtcgaaaatccgacaaaaattcaccagagaatcg
gatgattttcttggtcagacaattattgaagtaagaacattaagcggtgaaatggatgta
tggtataatcttgagaaacggacagataaatcagcagtatctggagctattcgtttactg
atttctgttgaaataaaaggtgaagaacaaatggcttcatttcatgtacagtatacagca
ttacatggtggcaatgaagcatggcgagtgtatttcaatccaataggacaggaaatcgtc
gatgaatttgctatacgttatggtattgaaccaatatttcaagcaatgacacattttgca
tgtttaactgctaaatacaactatcctggagtaccagctcaattatctgtacttttggct
aatataaatgcattttacgcacatacaacatcatcaaatagtcagacagctagtgaacga
ttcagtgcaagcaattttggaagagagaaattcattaaattattggacaatttatacatc
gccataagaattgatctgtcaaaatatcgtactgtatttcctgcatcacaaccagaaaga
ttgattgatttgaaatctaccgtagatcttcttacaagtatcacatttttccgtctcaaa
gttcaagagcttagttcacctccaagaacaggtcaaatattacgtgaatgtattgaagct
tgtatccatgcaacttatcagtgcctttgtgaaaatgtacatgatttatatgggaaaaaa
tctggaaatgctgaatttgtatctgataatatgaatagtggtactggacaatcgttaatt
ggggaattagatcaagtggatggtatacgatcattgacctattggcatcgtcttatcaca
ttggttgtttcagttcttgaagatgatcgaaaacattatgcaccagtattaaatcaattt
ccacatgaaatcaatctaggtgatatgtcagctgagatgatatggaaatgtttatcagaa
gatttagctaatggattagttcagcatacaattacagcgaaatattattttaataatact
gaagaggatatattggatagtttatcaaaagtgaataaattacatgattcatctcagtca
actggacaaaataaagttgtcttaaaaagtggaatgaataaaatcaaatcttccgactat
atgaatctttgttttcgagtaaaatggttttataatacttatatagcaacactggcaaga
ttcaaaaattcagttcctgattatcctcgttggtttgaaggtctcgtattgatttggtta
gctgagaatgatgaagtatctgcaaattatttaagaaatgcttatgatcgtgacaaacaa
gatggttttcaatgttccagtgaacatgtgctctattcaaattctgttgttgatgtattc
actcaactaaatcaatgtttcgatgttatacgtaaacttgaatgtccagataaacaagtt
gaaggacactttttccatagattctcactaactgttgaaaaagttctccttgcttatgct
gatcgtgtgttagctgatttcccaacatataaaacggatcaacgtgtagcttgtatatta
gtaaataatacacaacaacttcgtgttcaactagaaaaagtttatgagaatatggcacgt
gaaagtcttgaatccaacactcgagatcgtttaagtgctcttcaaggtcgattaaatgaa
gtagttgataaactagctatccaactaactgatcagtttgaagccggggtgcgctcacat
gcacgtgaatgtggtaaacttttacagaagtgtagaccatcgaatagctcggataataca
actggtcgtggtgtcagtaaagaagatgaagcaaacgaatgcttacaaccgctaatggat
cattttgaaagtattttatctatactagcgaatgtctgtgataaaactgtattgaaaaga
atattaaagcaattatggaggataacaatgtgtaatttagaaaaacttgttgtactaccc
acagttactgatcagaaacaggaaacaacacgtgaacctgagaaaggtcttacaccatat
caatgtgaattacttggcatttgcttgaatacaattcgtgtatattttcatgctggtgga
cgtggtgtgaaacgttcgtttcttgataggagtcaagaactacatagtttacgacaagta
ttagcactatattctcaggctacagatgaattacttcgagattttatagctacacaaact
tcacaagattatctggccaatgaggagccagttggttacttaacacttcaagtagaaatt
ttcaaacaccctggtaccggtgaatataaagtaaatgtgaaaattcatacagcttcagat
ttgaattggtctcttgccactggaatgtttaggccatttgtagaagtttatatttttgga
ccgttattatctgatcgtaaacgtaaagctgctacaaaatcgaaatcagtcactacaatg
cccatttatcatgaaacatttgtatttttcttatctaatcaaagtgatcctgaatggtat
gaattacatttatctgtaaaagattattgttttggacgaactgatcgtcttgttggtgtt
acagtattatctttatctagagcattaaatcttggtgcaactccaattcgacttccatta
ggacgacgtttacattttacagaaactggatggacagtattacgtgtactttcacaacgt
gttaatacagatgatgtagctcgagagaagtcatcttcaaccaccataaaaacagttgca
cttatacccggtgatggaataggcccagaaatatctgcagctgttcaggaaattttcaag
tttgctgatgtccccattaaatgggaatcagtggatgtaacacctcgacctacagaagac
ggtcgctttcgtatgccacagtcttcactagatattatacgcaagcatggaattgggtta
aaaggtccactagctactccaatcgggaagggtcatcaatctttaaatttggcattacga
aaagagttcaatctttatgccaatgttcgaccatgtaaatctattgaaggctatgaaact
ccttataaaaatgttgatttggttacagttagagagaatactgaaggcgaatattctggt
atcgaacatgtgattgtggatggtgttgtacaaagtataaaattgattactgaagaagca
agtcgacgtgttgctagatttgcatttcaatatgcaaaagataatggtcgacgtagtgta
acagctgtgcataaagctaatattatgcgaatgtcagatggtttattccttcgagtatgc
cgtgaagaagccgcacaccatagggagattgaattttgtgatatgtttttagatactgtc
tgtttaaatcttgttcaagatccaactcgtttcgatgtattagttatgccaaacttgtat
ggtgatatattgagtgatttagccgctggtttgattggtggtttaggtgttacaccaagt
ggtaacattggtgaaactggagccatatttgaatcagtacatggtaccgctcctgatatc
gctggtcaagatcgtgccaatccaactgctctactcttttcagccattatgatgcttcgt
tatatgaacttaaataagcacgcagatttgattgaatctgctgtattggccacaattcgt
gaagcgaagtatcttacagctgatcttggtggtcgttcaacatgttctcaatatactaaa
gaaatatgtcgtcaaattgaacagaaagcttcaaatcgataa

DBGET integrated database retrieval system