KEGG   Schistosoma mansoni: Smp_138770Help
Entry
Smp_138770        CDS       T01095                                 

Definition
histone deacetylase hda2
Orthology
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
smm  Schistosoma mansoni
Brite
Enzymes [BR:smm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Smp_138770
Protein phosphatases and associated proteins [BR:smm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Smp_138770
Messenger RNA biogenesis [BR:smm03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     Smp_138770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 1132 aa AA seqDB search
MSGNTSDQSFPGSARRKNRNPLSDKDIPVIFSAFDNSRHDYFDKQSSHDKGTAFIYDERM
LLHKNIWFPNFLECPERFSATIDKCTTYGLLSRCLIINPEPATDDFLTLYHQTKYIEQIK
QTTTMEDNELKQLSATLDSVYFNKHTDLSARLSVGSWIQAVDLIHHGDVRNAFCLVRPPG
HHALTNEACGFCIYNNVAIAANYAIEKLNYNRILIVDWDVHHGNTTQYAFYDNPKVLFIS
IHRYDNGEFWPNLRESNYDFIGTGRGRGFNVNIALNDVYIGDSDYLTIFHRIVLPLAYEF
DPELVLVSAGYDSSFGCPVGQLNLSPSLYAHLTHKLMAFAEGKVIVGLEGGYYLDTLSES
VGHTLSALLGDPMPSLDPMKPINPSVLETISNCISTLSFRWKFLHIYPLLNDNVLFPDIS
HLKLQSWSDVKVPNFEPTDKHHNVEDKLSIEKRFDYLKNAHPIAGNNKISGTCLVYDNRM
QNHKNEEDPTYPENPERIKHTYALLKQLGLKRRCKCIEARYATRTELLRVHTEEYVNTIA
STVNMEQTALNDFGASENSVYFNCVSVFFLNLIICSLVTDFEKYIMVFYLNGMALIRPPG
HHALKDRCMGFCFFNNVAIGARHAQQVYGLERIAIIDWDVHHGNGTAEIFEDDPNILYIS
VHRFDHGRYFPNSDFSSSQFCGTGEGLGRTIHIAWNGRDVKDGDYIVAFTNIIIPILYEF
RPQLILVSAGFDAAHGDKLGRLGVSPECFAHLTHLLMTVVHLNPSVYTLNHRKNSPIIST
PTRQTRQRLQQEKSISYSGGLVLALEGGYQITALSQCVAHCVAALLGDNCPRLASNLSIS
EKSCKSMQQTIEIHSNYWNMLKGFDPVNRYYDQDSIRRPVIVHSKLNNLSLNDKQLVTKC
TSTPGDNNNHLDDEFSQLFKTKLTLNVNSSLNNTSDRLSSTSISKHLPERQCVDEQNSYE
TLNNNGGSTVAKTSGLVIDSSESHQHHQQQQPSTSNGSGFISEDIHDFFGLPSSHELTSQ
VFAVTPLSWCPHLISVQNNPNWKPDINSLCNSCNHSSENWVCLSCYSVYCGRYANSHMIE
HFNTTKHSIVLSYADLSTWCYQCESYVHNEVLLNMKRAVYQAKFGEDMPGSS
NT seq 3399 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaaacacatcagatcaatcgtttcctggtagtgcacgacgtaaaaatcgtaat
ccacttagtgataaagatataccagttatattttctgcatttgacaatagtagacatgat
tattttgacaaacaatcatcacatgataaaggaactgcttttatatacgatgaacgtatg
ttattacataaaaatatatggtttccaaattttttggaatgtcctgaacgtttttctgca
acaatagataaatgtacaacttatgggttattatcacgttgtttaatcataaatcctgaa
ccagcaactgatgatttcctcacactttatcatcaaacaaaatatatcgaacaaattaaa
caaacaacaacaatggaagataatgaattaaaacaattaagtgccacattagattctgtt
tattttaataagcatactgatctttctgcaagattatctgttggatcatggatacaagct
gttgatttaatacatcatggtgatgtaagaaatgctttctgtttagtcagacctccaggt
catcatgcactgacgaatgaagcttgtggattttgtatatacaataatgtagcgattgcg
gcgaattatgcaattgaaaaattgaattacaatcgtatacttatagttgattgggatgta
catcatggaaatactacacaatatgcattctacgataatccaaaagttcttttcatatca
attcatcgatatgataatggagaattttggcctaatctacgtgaatcaaattatgatttc
attggtactggtcgtggtcgtggattcaatgtgaatattgcattaaatgatgtatatatt
ggtgattccgattacttaactatatttcatcgaattgttcttcctttggcctatgagttt
gatccagaattagtacttgtttccgctggatatgattcttcatttggctgtcctgtggga
caattaaatcttagcccttctttatatgctcatcttacgcataaacttatggcatttgct
gaagggaaagttattgtcggtttagaaggtggttattacctggatactttaagtgaatca
gttggtcatactttgtctgctctattaggtgatccaatgccatctttagatccaatgaaa
ccaattaatccaagcgttttggaaacaatatccaactgtatatctacattaagttttcgt
tggaaatttttacatatttatcctttattaaatgataatgtactattccctgatataagc
catttaaaattacaaagttggtctgatgtgaaagttccaaattttgaacctactgataaa
catcataatgttgaagataaattaagcatagaaaaaagatttgattatttgaaaaatgct
catccaattgctggtaacaataaaatatccggaacctgcttagtttatgacaatcgaatg
caaaatcataagaatgaagaagatccaacatatccagaaaatccagaacgtatcaaacat
acttatgcacttttgaaacaacttggccttaaacgtcgttgtaaatgtattgaagcacgt
tatgcaactcgaacagaactattacgtgtacatacagaagaatatgtgaatacaatagct
tcaactgtgaatatggaacaaacagctttgaatgattttggtgcttcagaaaattctgtt
tatttcaactgtgtaagtgttttttttctcaatctaatcatttgctcactagtgactgac
ttcgaaaagtacatcatggtgttctatttaaatggtatggcattaattcgtccaccaggt
catcatgctttaaaagatcgttgtatgggattttgttttttcaataatgtggcaatcggt
gctagacatgctcaacaagtctatggactagaacggattgcaattattgactgggatgtt
catcatggtaatggtacagcggaaatatttgaagatgatccaaatatattatacatatca
gtacatcgttttgatcatggacgttattttccaaatagtgattttagttcaagtcaattt
tgtggtactggtgaaggtttaggtcgtacaattcatattgcatggaatgggagagatgtt
aaagatggtgattacattgttgctttcacaaatatcatcattccaatattatatgagttt
cgaccacagctgattctggtttcagctggatttgatgctgctcatggggataagttgggt
agattaggtgtatctcctgaatgtttcgctcatttaacacatttattaatgacagttgta
catttaaatccatctgtatatacattaaatcatcgaaagaattcacccatcatatcaact
ccaactagacaaactcgtcaacgtttacaacaagaaaaatcaatatcctattctggtgga
ttagtattagctttagaaggtggctatcaaataactgctttatcacagtgtgttgctcat
tgtgtagctgcattattaggtgataattgcccacgtttagcatcgaatctttccatctct
gaaaagagttgtaaatctatgcaacaaactattgaaattcattcaaactattggaatatg
cttaaaggtttcgatccagttaatcgttattatgatcaagattcaatacgtcgacctgta
attgttcattcaaaattaaataatcttagtttaaatgataaacaacttgttacaaaatgt
acatcaactcctggtgataataataatcatttagatgatgaattttctcaattgtttaaa
acaaaattaacattaaatgttaattcctcactaaataatacaagtgataggttgagttca
acatcaatatctaaacatctaccggaaagacaatgtgttgatgaacagaattcttatgaa
actttgaataataatggcggatcaactgtggcaaaaacatcaggattagtcatagattcc
tcagaatctcaccaacaccaccaacagcaacaaccatcaacatctaatggtagtggtttt
atttcagaggatattcatgatttctttggattaccttcttcacatgaattaacttctcaa
gtgtttgctgtcacaccattaagttggtgtcctcatttaatatctgttcaaaataatcct
aattggaaacctgacataaatagtttgtgtaattcttgtaatcattccagtgaaaattgg
gtttgtctatcatgttattcagtttactgtggtcgttatgctaattcacatatgattgag
cattttaatacaacaaaacattcaattgtacttagttatgctgatttatcaacatggtgt
tatcaatgtgaatcttatgtgcataatgaagtattattgaatatgaaacgtgctgtttat
caagcaaaatttggtgaagatatgccaggttcttcttga

DBGET integrated database retrieval system