KEGG   Schistosoma mansoni: Smp_141770Help
Entry
Smp_141770        CDS       T01095                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
smm  Schistosoma mansoni
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Smp_141770
Enzymes [BR:smm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Smp_141770
Exosome [BR:smm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Smp_141770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 625 aa AA seqDB search
MATDKYIPTGIDKKQVDNNENEKFIAAIDQGTSSSRVIIFSINNGSIIAMHQISVTQSYP
SPGWIEMDANQIYTTILECLNKCVEQLKSVNKSTKDIVGVGITNQRETTIAWNSETGEPL
APAIVWSDARTADDVKKFIRIAPGNKSNAFQLITGLPIHSYFSALKMNWLLNNVKSVAEA
DEGNKLLFGTVDSWLIWKLTSQMCHVTDVTNASRTLLFNLNTLEWDHDLCKFFHINPRTL
PKIVTSSELIGVIQDSKCLMKGITIYGILGDQQASLVAQTWGLSCSVNENNLSDLSKVKV
TYGTGAFMLWNIGCQPYFSDKGVLTTIAYKMGSKGRPYYALEGAISFAGATMRWLKTKLD
AFKDDAECEKLSASVYRKQGFNEPDPCYLVPAFSGLFCPWWQESARCVICGITANVDKSD
LIYAGLRSSVYQTYDVLFVATLAKANNKYHSLAPLMTLKKPTEIMVDGGMSNSDTLMQSL
ADILNVTVRRHNHSDVMTALGAAITVALALDIDPTGLLKIREYSSYKSDDYQSTFYSKIS
SNDRAVKLYGWHESVKRSLHWIPNKSINESQNTLLDSLDLICNEECENENRIKKNQCSLN
SQKISFGLTAIGLFLLGLFVGQRIK
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgataaatatattcccactggtatagataaaaagcaggttgataataatgaa
aatgagaagtttatagcagctattgatcaaggtacaagtagttcaagagtgattatattt
tcaatcaacaatggaagtataatagctatgcatcaaataagtgtaacacaaagttatccg
tcacctggatggattgaaatggatgctaatcagatttatacaacaattctagaatgttta
aataaatgcgtggaacaattaaaatcagtaaataaaagtaccaaagatattgttggtgtt
ggtattacaaatcaacgtgaaacgactattgcatggaatagtgaaacaggtgaaccatta
gctccagctattgtttggtctgatgcaagaactgctgatgatgttaaaaaatttatacga
atagctcctggtaataaatcgaatgcttttcagcttattacaggtttaccgatacatagt
tatttctcagctttaaaaatgaattggttattaaataatgtcaagtccgtggctgaagca
gatgaaggaaataaattgttatttggtacagttgactcatggctgatatggaaattaact
agtcagatgtgtcatgttactgatgtaacgaatgcaagccgtacactactatttaatttg
aatacattagagtgggatcatgatctgtgcaaattttttcatattaatccgcgtacactt
ccaaaaatagtaacatcatctgaattaatcggtgttattcaagattcaaaatgtttaatg
aaaggcattacgatttatgggatattaggtgatcaacaagcatcacttgttgcacaaaca
tggggactgtcttgttctgtaaatgaaaataatttatcagatttatccaaggttaaagta
acgtatgggactggagcatttatgctatggaatattggttgtcaaccatatttttcagat
aaaggtgttctaaccacaatagcttataaaatgggttcaaaaggaagaccatattatgct
ttagagggtgctatatcatttgctggggctacaatgagatggctaaagactaaactggat
gcgtttaaagatgatgcagaatgtgagaaattgtctgcttcagtatacaggaaacaagga
tttaatgaaccagatccatgctatttggttccagcatttagtggtcttttctgtccatgg
tggcaagaaagtgcacgttgtgttatttgtgggattacagcgaatgttgataaatctgat
cttatttatgctggcttaagatcatctgtatatcaaacatatgatgttctctttgtggct
actttagctaaagctaataataaataccattcactagctccattaatgacattaaaaaaa
ccaactgaaattatggttgatggtggaatgtccaatagtgacactcttatgcaaagttta
gctgacattttgaatgtaactgttcgacgtcataatcattctgatgttatgactgcatta
ggtgcagcaattactgtggcattagcactggatattgatccaactgggttattaaaaatt
cgagaatattcatcttataaatcagatgattatcagtcaacattttattcaaaaattagt
tcaaatgatcgtgcagttaaattatacggttggcatgaatcagttaaacgaagtttacac
tggatacccaataaatcaataaatgaatcacagaatacacttctcgattcattggatctt
atttgtaatgaggaatgtgaaaatgagaacagaattaaaaaaaatcagtgttcattgaat
tcacaaaaaatatcgtttggtctaacagctattggtttatttttacttggactgttcgtt
ggtcaaagaattaaatga

DBGET integrated database retrieval system