KEGG   Schistosoma mansoni: Smp_142050Help
Entry
Smp_142050        CDS       T01095                                 

Definition
serine/threonine protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
smm  Schistosoma mansoni
Pathway
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:smm00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    Smp_142050
   04068 FoxO signaling pathway
    Smp_142050
   04150 mTOR signaling pathway
    Smp_142050
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Smp_142050
Enzymes [BR:smm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Smp_142050
Protein kinases [BR:smm01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Smp_142050
Exosome [BR:smm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Smp_142050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 390 aa AA seqDB search
MSKPTIPTVKGQIFELGPRFDNVQYVGEGAYGIVVSAFDCQRNEKVALKKVSPFEHQTYS
QRTYREIWILSRMDHENIVKIHDIITSSTFEEMKDIYIVECFMETDLCRLLKTQKLSNDH
ICYFLYQMLRGLKYIHSANVLHRDLKPCNILLNAACDLRICDFGLARIADPESEQSGTLT
EYVATRWYRAPEIMLTSKLYTKAIDIWSIGCIMAEMLSNRVLFPGKHYIDQLNLILQVLG
SPSKEDFETIVNLKARAYLESLPHRTKVPWIQLYPYASESALDLLDKLLCFVPSRRITVE
DALAHPYLEQYYDPTDEPVFEHPFIQQPDNFPKEKLKILIWEEIQRYRSNKTINDIVYIN
NNRKVEHMDDQSDKLVSEGTMAPGIVPISQ
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaccaacaataccaacagtgaaaggacaaatatttgagttagggccaaggttt
gacaacgttcagtatgttggggaaggtgcgtatgggatcgttgtatcggcgttcgattgt
cagcgtaatgaaaaagtagctctcaagaaagtttccccatttgaacatcagacatatagt
cagagaacatacagggaaatttggatacttagtagaatggaccacgaaaatattgtgaaa
attcatgatattataacgtcgagcacatttgaagagatgaaggatatctatattgttgag
tgttttatggaaactgacctgtgtcgcttactgaagacacagaaactaagcaatgaccat
atttgctactttttatatcaaatgcttagaggcctcaagtacatacattctgcaaatgtt
cttcatagggatcttaagccgtgcaacatcttgttgaatgcagcgtgtgacttaagaatc
tgtgattttggtttagctcgtatagctgatccagaatcagaacaatcgggtacattaaca
gaatatgtagctacacgttggtatcgtgcaccagaaataatgcttacatcaaaattatat
actaaagcaattgatatttggtcaattggttgtattatggctgaaatgcttagtaatcgt
gttttattccctggaaaacattatattgaccaattgaacttgatattgcaagttttaggt
tcaccatcaaaagaagattttgaaacaattgtaaaccttaaagctcgtgcctatttagaa
tcattgccacatcgtacaaaagtaccatggatacaattatatccatatgctagtgaatca
gcgctggatttattggacaaattactatgctttgttccgtcacgacgtataacagttgaa
gatgctttagcccatccatatttagaacagtattatgatccaacagatgaacctgtcttt
gaacatccatttattcaacaaccagataattttcctaaagaaaaattaaaaattcttata
tgggaagaaattcaacgatatcgtagtaataaaactatcaatgatatagtttatatcaat
aataataggaaagttgaacatatggatgatcaatcagacaagttagtctcagagggaaca
atggcaccaggaattgtaccaatcagtcagtga

DBGET integrated database retrieval system