KEGG   Schistosoma mansoni: Smp_142050Help
Entry
Smp_142050        CDS       T01095                                 

Definition
(RefSeq) Extracellular signal-regulated kinase 1/2,putative
Organism
smm  Schistosoma mansoni
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
GeneDB: 
UniProt: 
Position
Unknown
AA seq 390 aa AA seqDB search
MSKPTIPTVKGQIFELGPRFDNVQYVGEGAYGIVVSAFDCQRNEKVALKKVSPFEHQTYS
QRTYREIWILSRMDHENIVKIHDIITSSTFEEMKDIYIVECFMETDLCRLLKTQKLSNDH
ICYFLYQMLRGLKYIHSANVLHRDLKPCNILLNAACDLRICDFGLARIADPESEQSGTLT
EYVATRWYRAPEIMLTSKLYTKAIDIWSIGCIMAEMLSNRVLFPGKHYIDQLNLILQVLG
SPSKEDFETIVNLKARAYLESLPHRTKVPWIQLYPYASESALDLLDKLLCFVPSRRITVE
DALAHPYLEQYYDPTDEPVFEHPFIQQPDNFPKEKLKILIWEEIQRYRSNKTINDIVYIN
NNRKVEHMDDQSDKLVSEGTMAPGIVPISQ
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaccaacaataccaacagtgaaaggacaaatatttgagttagggccaaggttt
gacaacgttcagtatgttggggaaggtgcgtatgggatcgttgtatcggcgttcgattgt
cagcgtaatgaaaaagtagctctcaagaaagtttccccatttgaacatcagacatatagt
cagagaacatacagggaaatttggatacttagtagaatggaccacgaaaatattgtgaaa
attcatgatattataacgtcgagcacatttgaagagatgaaggatatctatattgttgag
tgttttatggaaactgacctgtgtcgcttactgaagacacagaaactaagcaatgaccat
atttgctactttttatatcaaatgcttagaggcctcaagtacatacattctgcaaatgtt
cttcatagggatcttaagccgtgcaacatcttgttgaatgcagcgtgtgacttaagaatc
tgtgattttggtttagctcgtatagctgatccagaatcagaacaatcgggtacattaaca
gaatatgtagctacacgttggtatcgtgcaccagaaataatgcttacatcaaaattatat
actaaagcaattgatatttggtcaattggttgtattatggctgaaatgcttagtaatcgt
gttttattccctggaaaacattatattgaccaattgaacttgatattgcaagttttaggt
tcaccatcaaaagaagattttgaaacaattgtaaaccttaaagctcgtgcctatttagaa
tcattgccacatcgtacaaaagtaccatggatacaattatatccatatgctagtgaatca
gcgctggatttattggacaaattactatgctttgttccgtcacgacgtataacagttgaa
gatgctttagcccatccatatttagaacagtattatgatccaacagatgaacctgtcttt
gaacatccatttattcaacaaccagataattttcctaaagaaaaattaaaaattcttata
tgggaagaaattcaacgatatcgtagtaataaaactatcaatgatatagtttatatcaat
aataataggaaagttgaacatatggatgatcaatcagacaagttagtctcagagggaaca
atggcaccaggaattgtaccaatcagtcagtga

DBGET integrated database retrieval system