KEGG   Schistosoma mansoni: Smp_142970Help
Entry
Smp_142970        CDS       T01095                                 

Definition
(RefSeq) putative palmitoyl-protein thioesterase
  KO
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
smm  Schistosoma mansoni
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    Smp_142970
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Smp_142970
Enzymes [BR:smm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     Smp_142970
Lipid biosynthesis proteins [BR:smm01004]
 Fatty acid synthase
  Component type
   Smp_142970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
GeneDB: 
Position
W
AA seq 298 aa AA seqDB search
MHNLLAWILLILKLSCTLTEKLPVIIWHGMGDRGTGMGILKLATAIQNEIPRTYVKCITT
SDSVIEDIEDTYFMPINDQLDYVCRMIHEDKNLSNGLHMIGISQGGLFVRALVQKCNFSK
VGTVVSIGGPQQGIFGIPKCINDGFIHLCLLMNELLSYGAYINFIQSHLVQAQYWHDPLE
EDVYRKYSQFLADINQENEINEIYREKMKNIQRLVLVKFSGDTIVIPKESEASWFGFYQN
GSSTNTTTLQDSILYTEDRLGLKELDKRGDLHFIEKDGDHLHFDVNWFIEKIVIAFLK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcacaatttgttagcgtggattttactgattttaaagttgtcatgtacattgacagag
aagttgccagttattatctggcacgggatgggcgatcgagggacgggtatgggtatactt
aagctggctactgcgatacaaaacgaaatacctaggacatatgtcaaatgcattaccact
agtgactcagtaattgaggatattgaagatacatatttcatgccaatcaacgatcaattg
gattatgtttgtcgcatgatacatgaagacaaaaacttatctaatggtttacatatgatt
ggtatatcacagggtggattatttgttagagcgttagtccaaaaatgcaatttctcgaaa
gttggcaccgttgtttcgattggaggacctcaacagggtatatttgggattccgaaatgc
attaatgatggctttattcatctatgcttattaatgaacgagctactttcatatggagcc
tatataaattttattcagagccaccttgttcaagctcaatactggcatgatccattggag
gaagatgtctatcgcaaatactcccaatttttagctgatattaatcaggaaaatgaaata
aacgaaatttatcgtgaaaaaatgaaaaatattcaaagattagtattggtaaagttttcg
ggtgacactattgtaatccccaaagaatctgaagcaagttggtttggattttatcagaat
ggatcgtcgacaaatacaacaacgttacaagacagcattctgtatactgaagatcgtcta
ggtcttaaagaacttgataaaaggggtgatttacattttattgaaaaagatggtgatcat
ttacattttgatgtgaattggtttattgaaaagattgttattgcttttttgaaataa

DBGET integrated database retrieval system