KEGG   Schistosoma mansoni: Smp_145290Help
Entry
Smp_145290        CDS       T01095                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
smm  Schistosoma mansoni
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:smm00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 513 aa AA seqDB search
MLPNVLSTAPKPLLFFIAVILSLYKIECKSSSLNVADPGTWKRLADERFDKFEQSSSHLL
LKRPENVILFIGDGMSLSTVTGARYLKAEKMDLLGGDVQLVWENWPVASLVRTFNSDRLT
TDSGSAATAFMSGVKSPHKTVGITGTVKCCKCTELKELERAKSSIMYASKAGFSTGIVTT
ARVTHATPAAAYANMLHRDWESKAPSNEHGFHCTDAATQLLSNASHVNVIMGGGATEFYG
PSDSTIFNMKGKRSDSRNLLHKWKAIQTKMNRKHVLLHTNSEFKRTNWSSVDYVLGLFAP
SHLAYRLENQDQPSLAEMTEAAIKVLSRNPKGFLLLVEGGRIDHGNHENRAHFPLHETFV
EVVQLMYIRHDIQFHKGFDEYRNVVKWIRIMERDFLILPYFVLQGDDNKSYLISSFFNGP
RGILGAPRSDPATEDRFASNYTAESLVRLSTSTHSAEDVPIYASGPFSDLFHSSLDNTFI
AHATMYSLCIGPYTNQSHCDKGNNGSRLRGLYL
NT seq 1540 nt NT seq  +upstreamnt  +downstreamnt
atgcttccaaatgtcttatcgacagctccaaaacccttactatttttcatagcagtcata
ctatccctgtacaaaattgagtgcaaatcgtcatcattgaatgtcgcagatcctggaact
tggaagaggttagcagatgagagatttgataaatttgaacaatcatcatctcacttatta
ctcaaacgaccagaaaatgtcatcttatttattggtgatggtatgagcctgagcactgtt
actggagcaagatatttgaaagcggagaagatggatcttttaggtggtgatgtacaacta
gtatgggagaactggcctgttgcatcacttgttcgtacattcaactcagatagactgaca
acagattcaggttctgcggcgactgcctttatgtcaggtgtgaaaagccctcataaaacc
gttggtatcacaggaacagtgaagtgctgtaaatgtactgaattgaaagaattagaaagg
gcgaaatcttctatcatgtatgcctccaaagcaggattttccaccggaatagttacaact
gcgagagttactcatgcaacacccgcagcagcgtatgcaaatatgttacatcgagattgg
gagtcgaaagctccatcaaacgagcacggattccactgcacagacgctgctacacaacta
ctgtccaacgcttctcacgtcaacgtaataatgggaggaggagcaaccgaattctatggt
ccgtcagacagtaccattttcaacatgaaggggaaacgctctgattcacgcaacctctta
cataaatggaaggcgatacagactaaaatgaatcgcaagcatgttctcttacatacgaac
tctgagtttaaacgaaccaactggtcttcagttgactacgttttgggtttgtttgctccg
agtcatttggcttaccgactggaaaatcaagaccaaccaagtttggcagaaatgactgaa
gctgctatcaaagtactttcgcgcaatcctaaaggatttcttttgttagtcgaagggggc
agaatcgatcatgggaatcacgaaaatcgagcacatttccctttgcatgagacgtttgtc
gaggtcgttcagttgatgtatattcgtcatgatatccagtttcacaaaggatttgatgaa
tatcgaaatgttgttaagtggatacggattatggagcgagattttctaatattgccttat
tttgtgttacagggagatgataataaatcatatctcatatcctcctttttcaatggacca
agaggtatattaggtgcacctcgatcggatccggcaacagaagatagattcgcaagcaac
tatacagcagaatcactggtgagactcagtacttctacacacagtgctgaggatgtaccg
atttatgctagtggacctttcagtgatctatttcactcttcattggataatacgtttatt
gcacatgcaactatgtactcgctttgtattggaccatacacgaatcagtcacactgtgac
aaaggaaacaatggatctcgactcagaggactttatctga

DBGET integrated database retrieval system