KEGG   Schistosoma mansoni: Smp_146330Help
Entry
Smp_146330        CDS       T01095                                 

Definition
phospholipase C beta
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
smm  Schistosoma mansoni
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:smm00562]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:smm04310]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:smm04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 829 aa AA seqDB search
MTSDIAKRQRTVPSAKAFEFIWKRPVPEVLQTGEHFDRYDEETGILEPNCFVRVDKDGFF
IYWQSENNDSQQLELSQISDVRSGAKPKFWIQSLRSLTHNTKAANVCPMTQLRKHWLRLT
LTLNARNRIPVRVIMKTFASGRNERIVYQSLKDLNLPHGKNDDIDPNEFPFEKFYELYHK
ICPRTDIEDLFKSLSNGKSHIHADKMIEFLNETQRDPRLNEILYPFANKQTIKYIQENYE
TQEEFKNTDEVSIECFYRYLMSDDNACVFLDKLDIYQDMDQPLSHYYINSSHNTYLIGRQ
FGGKSSVEMYRQVLLAGCRCIELDCWDGRGEDQEPIITHDGDGCSANKANNGEITATTTT
TTGSGGGGDTVIPLNTTPTPQLVSCTSSAELKRLQLKKEEGNLTAEEEQIMMAHYHYTGA
TSSIHPLLSSFVNYAQPVKFQGFDVAEDENIHHHMSSFSETVALGLLKNQAIEFVNYNKR
QMSRIYPRGNRVDSSNYMPQIFWNAGCQMVALNFQTPDLAMQLNQGKFEYNGNCGYLLKP
EFMRRPERQFDPFSESPMDGVIAATCEVKIISGQFLSDRKVGTYVEVDMYGLPTDTIRKE
FRTRVVPNNGLNPVYGDDAVFVFRKVVLPDLAVLRFAVYEDTGKLIGQRVLPLDGLQAGY
RHISLRTEGNFPLSLPTLFCQVSLTTYVPEGLNDLVDALSDPRAFLSKEEQRMKQLASMG
IDSSEIADVPGSVMSNISGSGETSNVSLNSTKKDEKKDDPKFDPISITLLQTDKMYQKLI
KKQAKELEILQKRQEKDAVSMLRNHTIITDKLNTSHAKERSSTKRTVNK
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcagatatcgctaaacgtcagagaactgttccatcagctaaagcatttgaattt
atctggaagagaccggttcctgaagttttgcagactggggagcatttcgatcgatatgat
gaggaaacaggaattctggaaccaaactgtttcgttcgagtagataaagatggctttttt
atatattggcaaagtgaaaacaatgatagtcagcaacttgaactctctcaaataagtgat
gttcgttctggggcaaaacctaagttttggatacaatcccttcgtagtttaacgcataat
accaaagcagctaatgtttgccccatgactcaattaagaaaacattggctacgacttaca
ttaactttgaatgctcgtaatcgaattcctgtccgtgtaattatgaagacatttgcctca
ggtcgtaatgaacgaattgtatatcaaagtttaaaagatttaaatttgcctcatggaaag
aatgatgatattgatccaaatgaattcccatttgaaaaattctacgaattatatcataaa
atatgtcctcgtacggatattgaagatttatttaaatctctatcgaatggcaaaagtcat
atacatgcagataaaatgatagaatttcttaatgaaactcaacgtgatcctcgcttaaat
gaaattctctatccatttgctaacaaacaaactattaagtatattcaagaaaattatgaa
acacaagaagaattcaaaaatactgatgaagtatccattgaatgcttttatcgttattta
atgtctgatgataatgcatgtgtatttttggacaagttagatatttatcaagatatggat
caaccactcagtcattattatattaattcatcacataatacgtatttgattggacgacaa
tttggtggtaaatcatctgttgaaatgtatcgacaagtattattggctggttgtcgatgt
attgaattggattgttgggatggtcgaggcgaagatcaagaaccaataatcacgcatgat
ggtgatggatgctcggcgaataaagcaaataatggagagatcacagcaaccactactact
actactggctccggtggtgggggtgatactgtaatacctctgaatacaacacctactcca
cagttggttagttgtacttctagtgctgaattgaaaagactacaattaaagaaggaggaa
ggaaatttaacagctgaagaagaacaaataatgatggctcattatcattatactggtgca
acaagtagtatacatccattattatcatcgtttgttaattatgcacaacctgtaaaattt
caaggatttgatgttgcagaagacgagaatattcatcatcatatgtcttcattcagtgaa
acagtggcattgggattgttaaagaatcaagcaatagaatttgtcaattataataaacgt
caaatgagtagaatttatcctagaggaaatcgtgtcgattcaagcaattatatgccacaa
atattttggaatgctggttgtcaaatggttgcgttgaattttcaaacccccgatttagcc
atgcagttgaaccaagggaagttcgaatacaatggtaattgtggttatttactaaaaccg
gaatttatgcgacgtccagagcgtcagtttgatccattctctgagtccccaatggatggt
gttattgcagctacatgtgaagtgaaaattatatcaggacaatttttatcagatcgtaaa
gttggcacatatgttgaagtagatatgtatggtttaccaacagatacaattcgtaaagaa
tttcgtactcgagttgtccctaataatggattaaatccagtgtatggagatgatgctgtt
tttgtatttagaaaagtcgttcttccagatcttgccgtattacgatttgcagtttatgaa
gatactggaaaattaataggtcaacgtgttttaccattagatggtttacaagctggttat
cgtcatatatctttacgtactgaaggcaatttcccactttctttacctactctgttttgt
caagtatcacttacaacatatgttcctgaaggattaaatgatttagttgatgctttatca
gatcctcgtgcgtttttaagtaaagaagaacaacgaatgaagcaactcgccagtatgggt
attgattcatcagaaatcgctgatgtacctggttctgttatgtctaatatttccggctct
ggcgaaacttcaaatgtttctttgaatagtactaaaaaagatgaaaagaaagatgatcct
aaatttgatccgatctcgatcactttattacaaactgataaaatgtatcaaaaattgatt
aaaaaacaagcaaaagaattagaaattttacaaaaacgacaagaaaaagatgctgtctct
atgttacgcaatcatacaatcattacagataaattgaatacaagccatgctaaagaacgt
tcaagtacaaaacgaacagtgaataagtaa

DBGET integrated database retrieval system