KEGG   Schistosoma mansoni: Smp_147040Help
Entry
Smp_147040        CDS       T01095                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
smm  Schistosoma mansoni
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Smp_147040
   00330 Arginine and proline metabolism
    Smp_147040
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Smp_147040
Enzymes [BR:smm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Smp_147040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 516 aa AA seqDB search
MGVYDYVFDLVKKDDSEMIDIYDLIELMNKAGISLNDPRLAKFAKSLNELQGNQINRNVI
QSKSLTLDRETFRIVAKENLHMLLRIMTNDFCIPDFESFTKEIQTVFNLCKENKSGQVAS
YIPELKEMNPNYWGLSLCTVDGQRLSMGDSTIPFTIQSSSKPITYALALTDLGPQYVHQY
VGYEPSGLPFNQISLNHKNHHGKPGSTGRPFRLIMRLLSSAHPRSRXXXXSAPTRSWQVP
GSNLAGFSNSSRFLSERETADRNFAIAYYMRENKCFPPTFELRELMDFYFQICSIEVTCE
SAGIMAGTLANGGINPLTNETVVSAAAARDTLSVMHSCGMYDYSGQFAFKVGLPCKSGVS
GIIMVVVPNLLGLAVWSPPIDRHGNSARGIQFCQELVHRFILHHYESHLHYDKKIDPRKP
RDSYRTDAVSTLLFAAGNNDLSTLRRCFIHGVDFNAIDYDGRTGLHVAASTGSLDAVKFF
IEVGGVKLNPIDRWGHTPLSDAKQFGHEKIIEYLER
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtttatgattacgtattcgatttagttaaaaaggatgatagtgaaatgattgat
atttatgatttaattgaattaatgaataaagctggtatatcattaaatgatccaagatta
gcaaaatttgcaaaatcattaaatgaattacaaggtaatcaaatcaatcgaaatgttata
caaagtaaatcattaacattggatagagaaacatttcgaattgtagcaaaagaaaatctt
catatgttattacgtattatgacaaatgatttttgtataccagattttgaatcattcaca
aaagaaattcaaacagtttttaatttatgcaaagaaaataaaagtggtcaagtagctagt
tatattccagaattgaaagaaatgaatccaaactattggggtttatcattgtgtactgta
gatggacaacgtttatctatgggtgacagcactattccatttacaatacaatctagtagc
aaaccaattacatatgctttagctttgaccgatttaggtccacagtatgttcatcaatat
gttggttatgaaccatcaggattaccatttaatcaaatttctttaaaccataaaaaccac
catggaaaacctggaagcactggacggccttttcgtcttattatgagactcctcagcagt
gctcatccacgatcccgcnnnnnnnnnntaagtgctccgacgcgaagctggcaggtcccg
ggttcgaatcttgcggggttttccaactcttctagatttttatcagaacgtgaaacagct
gatcgtaattttgctattgcctattatatgcgtgaaaataaatgtttcccaccaactttt
gaattacgtgaattaatggatttctattttcaaatatgttcaattgaagtaacttgtgaa
tccgcgggaattatggctggaacattagcaaatggtggtattaatccattgacaaatgaa
actgtagtaagtgcagctgcagcacgagatactttatctgttatgcattcatgtggaatg
tatgattattcaggacaatttgcattcaaggttggtttgccgtgtaaatctggtgtatcc
ggtataatcatggtagtcgtgcctaatttacttggtttagctgtttggtcaccgccaatt
gatagacatgggaattcggccagaggtatacaattctgtcaagaacttgttcatagattc
atactacatcattatgaaagtcatttacattatgataaaaaaattgatccacggaaacca
cgtgattcttatcgaacagatgcagttagtacattattatttgctgctggtaacaatgat
ttatcaaccctaagaagatgttttattcatggagtagatttcaatgcaattgattatgat
ggacgtactggtcttcatgtagctgctagtactggttcattagatgctgtaaaatttttc
attgaagttggtggtgtcaaattgaatccaattgatcgttggggacatacaccattatca
gatgctaaacaattcggtcatgaaaaaattattgaatatttagaaaggtaa

DBGET integrated database retrieval system