KEGG   Schistosoma mansoni: Smp_147920Help
Entry
Smp_147920        CDS       T01095                                 

Definition
ubiquitinyl hydrolase-BAP1 (C12 family)
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
smm  Schistosoma mansoni
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 318 aa AA seqDB search
MSQAEWLELESDPGLFTLLLEDFGVQGVQVEEIYDLSKPITEIVYGFIFLFHWNKAKKKP
CRRTGRGSTGSVSNTISPSSYTPVSTCDVRSNSVTPKTGNNGSRHRSASGSCQDIITTPE
FKSVGEISECKSIIPIPDKTEIFFAHQVVQNSCATHALLSILLNRPEINIGHMLAEFQKA
TRYLSPEAKGLAIGSMPQLAQAHNRHAAKPLTVCKDETISNLELPEPNTFHFVCYVPIGG
FLYELDGLTSEPINHGPLKNPNDQFAWTEQCADVLKERMQEYNEKGEMQLISLAALYCEP
YTTCLIFSVMPLVQPRVD
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggcagaatggctggagttggaaagcgaccctgggttatttactttacttttg
gaagattttggagttcaaggagttcaagtggaggaaatttatgacttatctaaacctatc
actgaaattgtttatggctttatatttttatttcattggaacaaagctaaaaagaagcca
tgtcgccgtactggaaggggttcaaccggttcggtaagcaatacaatttctccgagttct
tacacacctgtttccacttgtgatgtgcgatcaaattcagttacaccgaagacgggaaat
aatggttctcgtcaccgttcagcatctggatcatgccaggatattattactactccagag
ttcaagtctgttggtgaaatctcagaatgcaagtcgataattcctattccggacaaaaca
gagattttctttgctcaccaagttgtgcaaaattcttgcgctactcacgctttactgagt
attttgttaaatagacctgaaataaatataggacatatgttagctgaatttcaaaaagct
actcgttatttatcaccagaagctaaaggccttgccatcggaagtatgccacaacttgct
caggcacataatcgacatgctgcaaaaccgctaacagtttgcaaggacgaaacaatatct
aatttggaattacctgaaccaaatacatttcattttgtttgttatgttcctattggtggg
tttttatatgaactagatggtcttacatctgaaccaataaatcatggtccgttaaagaat
ccaaacgatcaatttgcttggactgaacagtgtgctgacgttttgaaggagcgtatgcaa
gaatataatgaaaaaggagaaatgcaacttatcagtcttgctgcgttatattgtgaacca
tatacaacatgtttgattttttcggtaatgcccttggtacaaccaagggtggattaa

DBGET integrated database retrieval system