KEGG   Schistosoma mansoni: Smp_147920Help
Entry
Smp_147920        CDS       T01095                                 

Definition
(RefSeq) ubiquitinyl hydrolase-BAP1 (C12 family)
Organism
smm  Schistosoma mansoni
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
GeneDB: 
Position
1
AA seq 1407 aa AA seqDB search
MSQAEWLELESDPGLFTLLLEDFGVQGVQVEEIYDLSKPITEIVYGFIFLFHWNKAKKKP
CRRTGRGSTGSVSNTISPSSYTPVSTCDVRSNSVTPKTGNNGSRHRSASGSCQDIITTPE
FKSVGEISECKSIIPIPDKTEIFFAHQVVQNSCATHALLSILLNRPEINIGHMLAEFQKA
TRYLSPEAKGLAIGSMPQLAQAHNRHAAKPLTVCKDETISNLELPEPSQAAATAAAIAKA
SIGTVNCVNSSDSSPSLATTTGSNVTIPDTFHFVCYVPIGGFLYELDGLTSEPINHGPLK
NPNDQFAWTEQCADVLKERMQEQDVRYNLLAVVPDRRVALTKRMQMLKRNRQLIQDILLR
MCQFDHTSKSLHCSNSNNITVTTATTTITTTTVSINHEHPRNQSNCHRHLIQEEYKSSPS
EHFINDDNCVHLPNSSLSVGKQYNPPCIEKCSPTSTNMSNCTNSTNTNSNNLDKNKHEPS
DDFENSRSIKTRSATRAAKQTIYENHNYPESELSKSMQQKHNHNSLSDTILTDSIHSPTN
DDYSTFCFSSRKRSSYSSPNEHDDPDCWECQHKKPYLHMSQQNDINNSSNNSCENGYNCN
SQLEYSPNTNKINRIFASFISNNSPLSLTVLTETMSSTVRKSNINKVSHSVGDDCKESKG
NLREIQDLENGIPNGISIKLQENCFHDVKNLHSLDHSSDQLTKVTSTSTSCTELNSCKVS
GPIYCGRSTISGEQNIPLKELTKPLTVETKLWCDTTSENLDAGDSETPVTSDIYPTNSSV
TSSNEICGTVLDSRPQTRALTRASLKLNSLSSVQASTEERISTTKISSDNVQLNKSVLMN
HESSVYNSDVSNKYRSLTEISPMTTDLTEFNISTSSSDITSSHRGSKYPTRSSTRMDTLA
SHNLAHLRSNPVTLHSNTSPSKVGRITSFEQTSTVHSTSNANTNTTNITSTYLSPFTYDY
MKLKNSPSLYPPPLSVEELNILLHKIDEQIKLCLSALIEEEEKRRSYRIDDARRIHNYEP
FIRAFLTALARHGMLKDQVLSAMKLKHTSVINHNHISSIQVSDSCKKSNVKAHHNNNSNN
KHVSNKMHTERIYSLTNNSSIKKRTYLSSSLINRLTRVNQSTNNNIRVAHHYNALNYRKL
RRRRRMRDSIRNSKSSCTGKDTGVVELKSPLVESADLTPSYRPPVTDESLPSITSSASCS
LQSVLTNSTTILQAPVVSTQSKNSRAIRINVNQQHSDETGESPLQGPLLISNSLCTDSCQ
KSSVTIDENSIVEGSLASSAVSSVTLASCSSCGSSPQSSNSSRSTNLRSNSSGVKLRQIK
SDDRVNTRRSLRPRVSREHAFTQDANISADSFSLTSEDPDTNNSGINLRDRTMKSSLRTH
NTDCTNCTVTESSTSSNSQRFRKRRLH
NT seq 4224 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggcagaatggctggagttggaaagcgaccctgggttatttactttacttttg
gaagattttggagttcaaggagttcaagtggaggaaatttatgacttatctaaacctatc
actgaaattgtttatggctttatatttttatttcattggaacaaagctaaaaagaagcca
tgtcgccgtactggaaggggttcaaccggttcggtaagcaatacaatttctccgagttct
tacacacctgtttccacttgtgatgtgcgatcaaattcagttacaccgaagacgggaaat
aatggttctcgtcaccgttcagcatctggatcatgccaggatattattactactccagag
ttcaagtctgttggtgaaatctcagaatgcaagtcgataattcctattccggacaaaaca
gagattttctttgctcaccaagttgtgcaaaattcttgcgctactcacgctttactgagt
attttgttaaatagacctgaaataaatataggacatatgttagctgaatttcaaaaagct
actcgttatttatcaccagaagctaaaggccttgccatcggaagtatgccacaacttgct
caggcacataatcgacatgctgcaaaaccgctaacagtttgcaaggacgaaacaatatct
aatttggaattacctgaaccaagtcaagctgcagcaaccgcagcagcaatcgctaaggct
agtataggaacggtgaattgtgtgaattcatccgattcgagccctagtcttgctactaca
acaggatctaacgtaacaattccagatacatttcattttgtttgttatgttcctattggt
gggtttttatatgaactagatggtcttacatctgaaccaataaatcatggtccgttaaag
aatccaaacgatcaatttgcttggactgaacagtgtgctgacgttttgaaggagcgtatg
caagaacaagatgttcggtataatttattagctgttgtaccagatcgtcgtgtagcgctt
acaaaacgcatgcaaatgttgaaacgtaatcgtcaacttattcaagatattctgttgcgt
atgtgtcagtttgatcatacgtccaaatcactacattgttctaatagtaataatattact
gttactactgctactactactattactactacaactgtttctatcaatcatgaacatcca
cgtaatcaatctaattgtcatcgtcaccttattcaagaggaatataaatcaagtccatct
gaacattttatcaatgatgacaactgtgtacatctgccaaactcatctttatctgtgggg
aaacaatataaccctccatgcatagagaaatgttcacctacaagcacaaatatgtctaat
tgtactaacagtactaataccaacagtaacaatcttgataaaaacaaacatgaaccatct
gatgactttgagaactcacgttccatcaaaactcgttcagcgacacgtgctgccaaacaa
acaatttatgagaaccacaactatcctgaatcagaattaagtaaatcaatgcaacaaaag
cataatcataattctctatctgatactattttaactgatagtatacattctcctaccaat
gatgattacagtacattttgtttttcatctcgtaaacgttcttcctattcatcaccaaat
gaacatgatgatccagactgttgggaatgtcagcacaaaaagccttatttacatatgtct
caacagaatgatatcaataatagtagtaataatagttgtgaaaatggttataattgtaat
tctcaattagaatattctccgaatacaaataaaataaataggattttcgcttctttcatt
tcaaataattcacctttatctcttaccgtacttactgaaacaatgtctagtacagttcgt
aagtcgaatatcaataaagtttctcattcagtaggagacgattgtaaagaatcaaaaggg
aatcttcgagaaatacaagatttagagaatggtataccgaacggaatttccattaaatta
caagaaaattgttttcatgatgtgaagaatttacattcacttgatcacagttcagatcag
ctaacaaaagtaacatccacatctacaagttgtacagaactaaattcttgtaaagttagt
ggacctatatactgtggtcgatcaacaatatcgggcgaacaaaacattccattaaaagaa
cttactaaacctttaactgttgaaacaaaattatggtgtgatactacttcagaaaatctt
gatgcaggtgactcggagacacctgttacaagtgatatatatcctacaaattcatcggta
acttcatccaatgaaatttgtggtactgttttagattcacgtccccaaacacgagcgctt
actagagcatctttaaagctaaattcacttagttcagtacaagcatcaactgaagagcga
atttccaccacaaagatatcatcagataatgtacaattaaataaatcggtactgatgaat
catgaatccagtgtatataattcagatgtgtcaaacaagtatcgttcacttacagaaatt
tccccaatgactacagacttaactgaattcaacatttcgacttcatccagtgatatcact
agttcacatcgaggatcaaagtatccaacaagatcttcaactcgaatggatactttagct
tcccataatttagctcatcttcgttcaaatcctgttactcttcatagtaatacgagtcct
tcaaaagttggtaggatcacttcttttgaacagacttctacggttcattccacttctaat
gctaatactaatactacaaatattacttcaacatacttatcaccatttacatatgattac
atgaaattgaagaattcaccaagtttgtatcctccgcctttaagtgtggaagaactgaat
atcctactgcataaaatagatgaacaaataaaactatgtcttagtgctttgattgaggaa
gaggagaaacgtcgatcctatcgtattgatgatgctagacgtatacacaattatgaacca
tttatacgagcttttctcactgccctagctagacatggaatgttaaaagatcaagtatta
tctgcaatgaaactgaaacatacatctgttattaatcacaatcatatttcatccatacaa
gtatcagacagttgtaaaaagtcaaatgtaaaagctcaccataataataacagtaataat
aaacatgtatctaataaaatgcatactgaacgcatctattcattgactaataattcttca
attaaaaagagaacttatctttcaagttcactaataaatagattaactcgagttaatcaa
tctacgaacaataatattcgtgtcgctcatcactataacgctttgaactatcgcaagcta
cgaaggagaagaagaatgagggattctattaggaattcaaaatcaagttgcaccggaaaa
gatacaggtgtagtcgaattaaaatctccattagttgaatcagctgatttaacaccatct
tataggccacctgtaacagatgagtcattaccatctatcacctcctctgcctcttgtagt
ttacaaagtgttttgactaactctacaactatacttcaagcacccgttgtatctacacaa
agtaaaaactcacgtgcaatacgaatcaatgtaaatcagcaacatagtgacgaaactggt
gaatctcctttacaaggcccattacttatttcaaatagtttatgtacagatagttgtcaa
aagtcatctgtaactattgatgagaatagtatagttgaaggtagtttggcttcttcagct
gtgtcatcagttacactagcatcctgttcatcatgtggttcatctcctcaatcatccaat
tcatcccggtcaactaatcttcggtccaattcttctggtgtaaaattaagacaaattaaa
tcagatgatcgagttaatactagacgttctttgcgaccacgtgtctctcgtgaacatgct
ttcacacaagatgcaaatatttcagctgactcttttagtctcacatcagaggacccggat
acaaacaatagtggaattaatttaagagatagaactatgaagtcatctttacgtacacat
aatactgactgtactaattgtactgtcacagaatcgtctacttcgtccaattcccaacga
tttcggaaacgacgtcttcattga

DBGET integrated database retrieval system