KEGG   Schistosoma mansoni: Smp_149820Help
Entry
Smp_149820        CDS       T01095                                 

Definition
(RefSeq) putative core 1 udp-galactose:n-acetylgalactosamine-alpha-r beta 1,3-galactosyltransferase
  KO
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
smm  Schistosoma mansoni
Pathway
Mucin type O-glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    Smp_149820
Enzymes [BR:smm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  N-acetylgalactosaminide beta-1,3-galactosyltransferase
     Smp_149820
Glycosyltransferases [BR:smm01003]
 Glycan extension
  Type 3 chain
   Smp_149820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
GeneDB: 
Position
4
AA seq 201 aa AA seqDB search
MHLWSKFRIILRYIYQFRNDYDYFLKTDDDTYIIMENLLNVLQNYSPDMPFMLGHRFMNI
ARNGYFSGGAGYVLSREALKRIVEQSIDKHHNCPVYDEDMEDVKMSICGQAVGVRLYDTF
DILGRYRFLWASLDMLYNFTSYRVLKWRPVKLQPNTLYAAPHQSLLSDVAISFHYITPDV
LYMLEYFLYHLHFYLTITSNI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcatttatggagtaaatttcgcatcatactacgttacatttatcaatttcgtaatgat
tatgattattttttaaaaaccgatgatgatacctatataattatggaaaatttattgaat
gttttacagaattattcaccagatatgccttttatgcttgggcatagatttatgaacatt
gcgcgaaatggttatttttctggtggtgcaggctatgttctatctagagaagcattaaag
cgtatagttgaacagtcaattgataaacatcataattgtccagtttatgatgaagatatg
gaagatgtaaaaatgagtatatgtggacaagccgttggtgttcgcctatatgatacattt
gatatacttggtcgttatcgattcttgtgggcgtcgcttgatatgttgtataattttaca
tcttaccgagttttgaaatggcgtcctgttaaactacaaccgaacaccttatatgcagca
ccacatcaatcattacttagtgatgttgcaattagttttcattatattacaccagatgtg
ttgtacatgttagaatatttcttatatcatttacatttttatcttacaataactagtaat
atttga

DBGET integrated database retrieval system