KEGG   Schistosoma mansoni: Smp_149820Help
Entry
Smp_149820        CDS       T01095                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
smm  Schistosoma mansoni
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:smm00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 341 aa AA seqDB search
MFTIRLDEAIKQTSEIQTHTHSNLSDSMKKLQYQNSRQAYSKFRGLCCLILGIGTVDADY
STKLYKKIRILCYINTHPENYYKKAIHIHKTWARRCTKHIFMSTKSDPILPIAVLKLPYP
EVRMHLWSKFRIILRYIYQFRNDYDYFLKTDDDTYIIMENLLNVLQNYSPDMPFMLGHRF
MNIARNGYFSGGAGYVLSREALKRIVEQSIDKHHNCPVYDEDMEDVKMSICGQAVGVRLY
DTFDILGRYRFLWASLDMLYNFTSYRVLKWRPVKLQPNTLYAAPHQSLLSDVAISFHYIT
PDVLYMLEYFLYHLRPIGLVNNFIQLPKEIVMNNEMIFILQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtttacaatacgattggatgaagcgattaaacaaacgtcagaaatacaaacacataca
cattctaacttgtctgattctatgaagaaactacagtatcaaaattcccgtcaggcatat
tctaaatttcgaggactatgctgtctgattctaggcattggaactgtagatgcagactat
tctacaaaactgtataaaaaaataagaatattgtgttatattaatacacatccagagaat
tattataagaaagccatacacatacataagacatgggctagaagatgtacaaagcatata
tttatgagtactaaatctgatccaattctgccaattgccgttttaaaattaccgtatcca
gaagtgagaatgcatttatggagtaaatttcgcatcatactacgttacatttatcaattt
cgtaatgattatgattattttttaaaaaccgatgatgatacctatataattatggaaaat
ttattgaatgttttacagaattattcaccagatatgccttttatgcttgggcatagattt
atgaacattgcgcgaaatggttatttttctggtggtgcaggctatgttctatctagagaa
gcattaaagcgtatagttgaacagtcaattgataaacatcataattgtccagtttatgat
gaagatatggaagatgtaaaaatgagtatatgtggacaagccgttggtgttcgcctatat
gatacatttgatatacttggtcgttatcgattcttgtgggcgtcgcttgatatgttgtat
aattttacatcttaccgagttttgaaatggcgtcctgttaaactacaaccgaacacctta
tatgcagcaccacatcaatcattacttagtgatgttgcaattagttttcattatattaca
ccagatgtgttgtacatgttagaatatttcttatatcatttacgtccaattggattagtg
aataattttatacaattacctaaagaaattgtaatgaacaatgaaatgatttttatctta
caataa

DBGET integrated database retrieval system