KEGG   Schistosoma mansoni: Smp_152000Help
Entry
Smp_152000        CDS       T01095                                 

Definition
ubiquitin-specific peptidase 8 (C19 family)
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
smm  Schistosoma mansoni
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:smm00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Smp_152000
Enzymes [BR:smm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Smp_152000
Peptidases [BR:smm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Smp_152000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 1027 aa AA seqDB search
MFFVPNFAFSSRLFLLHMLGQSCYLSSFRQLPVIAICGATGTGKSKLAVNLANVFGGEVV
NFDALQLYSGIDIATNKISHVECLGVPHHLIGIYPPEFGHRYDVHSYRDICLPLIENIRN
IRKKLPILVGGTHYYLEAILWEDFLASKHATSDSTSEFDRSTVPAVLQREMSLLKCQANE
VWEHDEERAYVLFMKYFEYYDKLKRLTGNKCSALLKNELLSSIERAEILRDSLKARYEDL
SRQTLPDVKRTIEPQQNHKPDKPQNVISSFWIQTNELAELIKKQHKFLLIDARSKIEFEQ
CRIAFDNTINLPYDIIKRGTTVNNISDYLQKNDFFKKLWDNRSKFDDIILLDENGFDSDQ
SVLNKNHPLQILKDAMLKWDAEQVLTAEPRILFKGMKDFRMRYPPLLIQTTISFNQKDSR
QINPQLEAPKFQYPDLNIREEQLPTVNLADLLASQSKDPTLSFKTIQNGRTGMNDGTSSV
FKRPLAPKPSTFNNRVQYTPKMMSSQSPEISLNNIRQTNSPVDHRLGVVSSGLSNLSVGK
SDLYSTNISSNLTLPYGSIKGDEDMKDNVWKLSDDNLDEEPLAYCDYHDKLHPDSTLNKL
SGQIIENTINRSNGPYANPWKASLSMSPSSVSLQSVPSIPPSETKPTNILHSHSSLTSFN
QSDVPNNQAIHQTRTNGLRNLGNTCYINSVVQSLSHTRALVHYFLDGFHERQAVVSNRLG
YGGEIVKHFEMLLSALYNQPNQDAELYKFRSAVAKHQSKFSSNDQQDSLEFLLFLLDGLH
EDLNEVKKNNNSTKLKHNESMIEYTSSNEQAEAAWIQHKDFNNSIIVSSFQGLLRSTVKC
NSCHVTSTTFDVFMVLSLPIEQNKCQLTDCLKLFLEKEEMVGQCRWHCPSCNTRRDASKW
IELWKLPTYLIIHLKRFRYEYGNWRKQTTNVDFPIECLDMSSFIVGPKLHSSEYALYSVL
NHRGTMESGHYTTFCRNIRDGRWYEYDDENVSLLDKNEIQNDNAYILFYELLPRVGVFFE
NTHNMVR
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atgtttttcgtgccaaattttgcttttagttcacggctgtttttacttcatatgcttggg
cagtcatgctacttaagttcatttcgccagcttcctgttatagctatttgtggagccact
gggactggaaaatcaaaactagcagtaaatctcgctaacgttttcggaggtgaggtcgtc
aatttcgatgcccttcaattgtatagtgggatcgatattgcaacaaacaagatatcacat
gttgagtgtttaggtgtcccacaccatcttatagggatctatcctccagaatttggacat
agatatgatgttcattcatatcgagacatttgtttacctctgattgaaaatataagaaat
atcaggaaaaagttacctattcttgttggtgggactcattattatttggaagctatttta
tgggaggattttctagcttcaaaacatgctacttccgactcaacaagtgaattcgataga
tcaactgtacctgcagtcttacaacgtgaaatgtctttattaaaatgtcaggctaatgaa
gtttgggagcatgatgaagagcgtgcctatgtattatttatgaagtattttgaatattat
gacaagttaaaacgtttaacgggcaataaatgctctgcattgctgaaaaatgaattattg
tcctccattgaacgtgctgaaattttacgtgatagtctaaaagctagatatgaagatcta
agtcgtcagactttacccgatgtaaaaaggaccattgaacctcaacaaaatcataaacca
gataaaccacagaatgtgatcagttcattttggatacagacaaatgaattagcagaactt
attaaaaagcaacataagtttttgctgattgatgctcgttcgaaaatcgagtttgaacaa
tgccgaattgcatttgataatactatcaacttaccatatgatattataaaacgtgggact
acagtaaataatatctctgattatttacaaaagaatgatttctttaaaaaactttgggat
aatcggtctaaattcgatgacataatactattggatgagaatggattcgattcagatcag
tcagttttaaataaaaaccatcctttgcaaattcttaaggatgctatgttaaagtgggat
gcagagcaagttttaactgctgaacctagaatactttttaagggaatgaaagattttcga
atgcgttatcctccacttctcattcaaacaaccatatcatttaatcaaaaagactccaga
caaataaaccctcaattagaagctcctaaattccaatatccagacttgaatatccgtgaa
gaacaattacctactgttaatttggctgatttgttggcttctcaaagtaaagatcctaca
ttgtcctttaaaactattcaaaatggacgtactgggatgaatgatggaactagttctgta
tttaaacgtccactagcacctaaaccatccacattcaacaatcgtgtacagtatactcct
aaaatgatgtccagccagtctccagaaatatcccttaacaacattagacaaaccaactct
ccagttgatcaccgactaggtgttgtatcatcaggtttatcaaatttatcggtgggaaaa
tctgatttatattcaacgaatatctcttcaaatctcactctcccatatggttcaataaaa
ggcgatgaagatatgaaagataatgtttggaaactatctgatgataatttggatgaagaa
cctcttgcctactgtgactaccatgacaaactacatcctgatagcacgttgaataaatta
tccgggcaaattatagaaaatacaattaatagatcaaatggtccttatgcaaatccgtgg
aaagcatctttatctatgtcacctagtagtgtttcacttcaatctgtaccaagtattccc
ccatctgaaactaaaccaacaaatattttacattctcattcatccctaacatcatttaat
cagtcagatgttccaaataatcaagctattcaccaaacacgtactaatggtttacgtaat
ctagggaatacatgttatataaattctgtagtacaaagtctgtctcatactagagcatta
gttcattactttctggatggttttcatgaacgccaagctgttgtatcaaatcgtcttggt
tatggtggtgaaattgtcaagcattttgaaatgctactctcagcgttgtataaccagcct
aatcaagatgctgaattatataaatttaggtcggctgttgcaaagcatcaatctaaattt
tctagtaatgatcaacaagatagtttagaatttcttctctttttattggatggtctacat
gaagatcttaatgaagtgaaaaaaaacaataattcaacaaagcttaaacacaatgaatca
atgattgaatatacttctagtaatgaacaagcagaagctgcatggattcaacataaagat
ttcaataattcaattatagtctcttcatttcaaggacttcttcgttccacggtgaaatgt
aatagttgtcatgtaacttctacaacatttgatgttttcatggtattatccttgcctatt
gaacaaaataaatgtcaattaacagattgtctcaagttatttcttgaaaaagaagaaatg
gttggtcaatgtcgttggcattgtccatcatgtaatacaaggcgtgatgcttccaagtgg
atagaattatggaaattaccgacatatttaattatacatttaaaaagatttcgatatgaa
tatggtaattggagaaaacaaacaaccaatgtagattttcctattgaatgtttagatatg
agttcgtttattgttggcccaaaattgcattccagtgaatatgctttatattctgttttg
aatcatcgtggtacaatggaaagcggtcattatacaacattttgtcgtaacatccgtgac
ggtcggtggtatgaatatgatgatgaaaatgtatctttattggataaaaatgaaatacaa
aatgataatgcttacatactcttctatgaattactacctcgtgttggtgtatttttcgaa
aatacacataatatggtccgatga

DBGET integrated database retrieval system