KEGG   Schistosoma mansoni: Smp_153810Help
Entry
Smp_153810        CDS       T01095                                 

Definition
l-asparaginase I
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
smm  Schistosoma mansoni
Brite
Enzymes [BR:smm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Smp_153810
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     Smp_153810
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     Smp_153810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 664 aa AA seqDB search
MHSKNARLYASKVIFGSNNKIKRDENQRSLFSSSRKIVSVVIITHCVRYLIDPVSRRWAS
FVGSPMIDQSLVDLALKIPKCLSVSRVLVLYTGGTIGMKCVNGSYCSVENFFLPTLNKMP
TFCDSDLTESDHIQTYALPIDKTGHRILYTVVEYWPLLDSSDLSMNEWKRIAQDIYAFYN
EFDGFVVLHGTDTLAYTASALSFMLENLGRPVVLTGAQLPVFEFRSDGWNNFLGALMIAG
GKYAICEVTVLFHAKLFRGSRVVKCSSNNFDAFESPNYPAIAELGTEITINYDLIFRTPG
LPKPFCIHTNLCQDVAILNIFPLISKEHIISMLAPPIKGVVLRTYGAGNIPSSRQDLLDA
LKEASDRGILMVNVTQCWRGGVKAVYSTGLVLNEYGVTPGYDMTTEAALTKLAYILSKTE
NKDYSSKRAMLLKSLRGEVTVEGEDSRAANLSLYNTNCLNQDRNLMIYFAKLFSTTSLDD
SEGCTPLHKSAFYGHISATKYLLECGVSVHIADKNGYTPLLCALNSLILSSELVQLLLDV
GAVLNSESQLVTKLVHQAVSDGDIQRLRLYQLCGYSFYNMDEEGRSALHVAVTHRQLDSI
KFLISPIYNEENSHNKERSNVETTELEYGAGVDPKCQTIWGTSALDEAKLRNFNDIVQLL
EKYQ
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgcattctaagaatgcaagattatacgcctcaaaagtaatatttgggtctaataacaag
attaagcgtgatgagaatcaacgttcactattttcgtcatcacgaaaaatcgtttctgtt
gtgataatcacgcattgcgtacgttatcttatcgacccagtctctagacgttgggccagt
tttgtgggaagcccaatgattgatcagtcattagttgatcttgcattaaaaattccaaaa
tgtttatctgtttcccgggttcttgttttatacactggtggtactattggaatgaaatgt
gtaaatggttcttactgttctgtggaaaacttttttcttcccaccttaaataagatgcct
acattttgtgattcagatttaactgaatcagatcatatacaaacttatgctttaccgatt
gataaaactggacatcgtattttatatacagttgtagaatattggccattattagattca
tctgatttaagtatgaacgaatggaagcgtatagcacaagatatttacgcattttataat
gaattcgacggctttgttgtattacatggaacggatacacttgcttatacagcatcagcc
ttatcatttatgttagagaatttaggtagaccagttgttttaactggagcacaattaccg
gtattcgaatttcgtagtgatggatggaataattttcttggtgcattaatgatcgctggt
ggaaagtatgcaatttgtgaagtcacagtgttatttcatgctaaattatttcgtggctct
agagtggtaaaatgttcaagtaataattttgatgcattcgagtcaccaaattatccagca
attgctgaattaggaactgaaataaccattaattatgatttaatttttcgaacacctgga
ttacctaaaccattttgtattcataccaatttatgtcaagatgttgcaatactaaatata
tttccattaatatctaaagaacatattatttcaatgttagcacctcctattaaaggagtt
gttcttcggacatatggagctggtaatattccatcttctcgtcaggacctactggatgca
ctaaaagaagcttctgatcgtggtatacttatggtaaatgtcacacaatgttggcgtggt
ggcgttaaagcggtttattcaactggtctggttctcaatgaatatggtgtaactccagga
tatgatatgacaactgaagcagcacttaccaaattggcctatatattgagtaaaacagaa
aataaagattattctagtaaacgtgcaatgttattaaagagtttaagaggtgaagtcaca
gttgaaggagaagactctagagcagctaatttatcactatacaacacaaattgtttaaat
caagatagaaatcttatgatatattttgccaaattattttcaacaacttctttagatgat
tctgaaggatgtactccactgcataaatcagctttctacggtcatatttcagcgacaaaa
tatttattagaatgtggtgtatcagttcatattgcagataaaaatggatatactccactt
ctttgtgctttaaatagtctaatcttatcttctgaattggtgcagttattattagatgtt
ggcgctgtattaaattctgaaagtcaacttgtcactaaactggttcatcaagcagtttct
gatggtgatattcaaaggttacgcttatatcaattgtgtggatattcattttataatatg
gatgaagaaggtcgttcagctttacatgtagctgttacacatcgacaattggattcaatt
aaatttctcatctcaccaatatataatgaagaaaattctcacaataaagagaggagcaat
gtagaaacaacagaactggagtacggcgctggtgttgatccaaaatgtcaaacaatatgg
ggtactagtgcattagatgaagcaaaactccgaaatttcaatgatattgttcaattgttg
gagaaatatcaatga

DBGET integrated database retrieval system