KEGG   Schistosoma mansoni: Smp_154420.1Help
Entry
Smp_154420.1      CDS       T01095                                 

Definition
(RefSeq) putative clathrin heavy chain
  KO
K04646  clathrin heavy chain
Organism
smm  Schistosoma mansoni
Pathway
smm04142  Lysosome
smm04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:smm00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Smp_154420.1
   04142 Lysosome
    Smp_154420.1
Membrane trafficking [BR:smm04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    Smp_154420.1
Exosome [BR:smm04147]
 Exosomal proteins
  Proteins found in most exosomes
   Smp_154420.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin Clathrin_H_link Coatomer_WDAD ANAPC3 TPR_1 PSD2
Motif
Other DBs
NCBI-GeneID: 8340533
NCBI-ProteinID: XP_018648355
GeneDB: Smp_154420.1
UniProt: G4VAK4
Position
1
AA seq 1334 aa AA seqDB search
MASRCNLPGAEDLFFKKFDSLFQSGQFPEAAKLAANAPKGILRTPQTIQRFQQVSSAPGQ
ASALLQYFGILLDQGQLNKFESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKQA
DPTLALSVYLRANVPPKVVQCFAETGQFQKIIVYAKKVGYTPDYIFLLRNLTRINPDQGL
QFAQMLVQDQEPLVDLEQVVNVFMDQGLVQQCTSFLLDALKHNRPSEGHLQTRLLEMNLM
SAPQVADAILGNQMFSHYDRAAIAQLCEKAGLLQRALEHYTDLYDIKRAVVSTHLLNPEW
LVNYFGSLSVDDSLECLRAMLQTNIRQNLQVCVQIATKYHEQLGTNALIEIFESFKSFEG
LFYFLGSIVNFSQEPEVHFKYIQAACKTGQVKEVERICRESNCYEPERVKNFLKEAKLTD
QLPLIIVCDRFDFVHDLVLYLFRNNLQKYIEIYVQKVNPARLPVVVGGLLDVDCSEDIIK
QLMAVVRGQFNTDELVAEVEKRNRLKLLLPWLESRVHEGSVEPATHNALAKIYIDLNNNP
ERFLRENQYYNSSVVGKYCEKRDPHLACIAYERGHCDQDLIRVCNENALFKTEARYLVRR
KEPELWAEALSESNSYRRQLIDQVVQTALSETQDPEEISVSVKAFMAADMPNELIELLEK
IVLDNSVFSDHRNLQNLLILTAIKADKSRVMEYINRLDNYDAPDVANIAINNSLFEEAFA
IFKKFEVNTSAIQVLIDHVKNFDRAYEFAERCNEPAVWSLLAHAQLAQGSIKEAIDSYVK
ASDPSRFQAVSEAASNSGNWEDLVRYLQMARKKARETFIESELAFAYARTNRLSDLEEFI
SGPNHANITVVADRCFDQQLYEAAKILYSNVSNYSRLAITLVHLGEYQGSVDAARKANST
RTWKEVCFACVNHKEFRLAQMCGLHIVVHADELGDLINYYEQRGHFDELIQLLEAGLGLE
RAHMGMFTELAILYSKFKPEKMREHLELFWSRVNIPKVLRAAEQAHLWSELVFLYDKYEE
YDNAILTMMSHPTEGWRENHFKDLITRVANVELYYKAIQFYLTYKPLLLNDLLMVLSPRL
DHTRAVNFFIKAGHIALVKPYLRFVQQNNANNKSVNEALNDLLIEEEDYQALRQSIETHS
NFDHIALAQQLERHELIEFRRLAALLFKGSNRWMQSIDLCKRDQLYSDAMQYAWDSRDPE
TAEELLRWFLSENLPDCFAACLYRCYDLLRPDVVLELAWRNGLIDMAMPFLIQTLRELTT
KVDRLERSEQTRAAEEEKAEQAVNPLVMRTEPQLMLPGPAGSMPAALIPPTGAPIGMFGV
TGPQMYYQTNGPSF
NT seq 4005 nt NT seq  +upstreamnt  +downstreamnt
atggcttccagatgcaatcttcctggtgcagaagatttgtttttcaagaaattcgattct
ctttttcaatccggtcagtttcccgaagctgcgaagttagcagctaatgctcctaaaggt
attttgcgcactccacagacaattcaacgttttcaacaggtgtcaagtgcaccagggcaa
gcatcagccctgttgcagtattttggaattctacttgaccaaggtcaacttaacaagttc
gaaagtctggagctttgtagaccagttttacaacagggtaggaaacagttgttggaaaaa
tggttgaaggaggacaaattagaatgttcagaggagttaggagatcttgttaagcaggcg
gatcctacactagctttgtcagtctacctaagggccaatgttccaccaaaggtcgtacag
tgttttgctgaaactggccagtttcagaaaatcatcgtttatgcgaagaaggtcggctac
acaccagattatatttttctgttacgcaacctaactcgtatcaacccagaccaaggtttg
cagtttgcccaaatgttggttcaggatcaagaacctttagttgatttagaacaagttgta
aatgtgtttatggatcaaggtttggtgcagcaatgtacatcattcttactggatgcatta
aagcataatcgaccttctgagggacatctccaaactcgtttattagaaatgaatctaatg
tcagcacctcaggttgcggatgcaattttgggcaaccaaatgttttcacattatgatcgg
gcagctattgctcagttgtgtgagaaagcagggttgttgcagcgggctttggagcactat
actgatctttacgacatcaaacgggctgtcgtaagtacacatttgttaaatcctgagtgg
cttgtcaattattttggctcactttctgtcgatgactcgttggagtgtttgagagctatg
ctgcagacaaatattagacaaaatctccaggtctgtgtccagattgctactaagtatcac
gaacagttggggacgaatgcgcttatcgaaatttttgaatccttcaaatcatttgaaggc
ctgttttactttttggggtctattgttaattttagtcaagaacctgaagttcattttaaa
tatattcaagctgcctgtaaaaccggacaagtcaaagaagttgaacggatttgtcgcgaa
agcaattgttatgaaccagaacgagttaaaaattttcttaaagaggcaaaacttacggac
caattacctcttattattgtctgcgatcgcttcgattttgttcatgatctcgtcctttat
ttgtttcgtaataatttgcagaaatacattgagatttatgtgcaaaaagttaatccagcc
cgtttaccggtagtcgttggaggccttttagatgttgattgttcagaggacataataaag
cagttgatggcagttgttcgtggtcagttcaatactgatgaacttgttgcagaagtggaa
aagcgcaatcggctgaagttattactgccatggcttgaatcacgtgtacatgaaggatct
gttgaacctgctacacataatgccctagcaaagatttacatagaccttaacaacaatcct
gaacgtttcttgagagaaaatcagtattataatagctctgttgtcggtaaatactgtgaa
aagcgtgatccacatttagcgtgtattgcatatgaacgtgggcattgtgaccaagatcta
atcagagtttgtaatgaaaacgcattattcaaaactgaagctcgttacttagttagacgg
aaagaaccggagctatgggcagaagctttaagtgaatctaatagttaccgtcgacaatta
attgatcaagttgttcagacagcactttctgagacccaagatcctgaagagatatccgtt
tctgttaaagcatttatggctgcggatatgccgaatgaacttattgaacttctggagaaa
atagttctggacaactcagtattttctgatcatcgcaaccttcaaaaccttttaatccta
actgcaattaaggctgataaaagtcgtgtcatggaatacattaatcgtttggataattat
gatgctcctgatgttgctaacatagccataaataattctctttttgaagaagcatttgcc
attttcaagaaatttgaagtcaacacatccgctatacaggttttgattgaccatgtcaaa
aattttgatagggcctatgaatttgctgaacgttgtaatgagccagctgtttggagtctt
ctagcacatgctcagttagctcaaggttccataaaagaagccatcgactcatacgtgaag
gcgtctgatcctagtcgattccaagcggtctccgaagctgcttcaaactctggaaattgg
gaagatttagttcgttatctccaaatggcacgaaagaaagcccgtgagacgtttattgag
tcagagcttgccttcgcctatgcaaggactaatcgtttgtcagatctcgaagagttcatt
tcagggccaaatcatgccaatataactgttgtagccgatcgttgttttgaccaacagcta
tacgaggcagctaagatattatattcaaacgttagcaactattcccgcctagcaataact
ttggttcacttaggtgagtatcaaggatctgtggatgctgctcgaaaagcaaattcaaca
cgcacttggaaagaagtatgtttcgcttgtgtaaatcacaaggaatttcgtttggctcaa
atgtgcggtctacatattgttgtacatgcagatgaattaggcgatcttattaattactat
gaacaacgcggtcactttgatgaacttattcaacttttagaagctggtttaggtttggaa
cgggcacatatgggaatgttcactgagctggcaatattgtattcaaagtttaagccggag
aaaatgcgggaacatttggagcttttctggtctcgtgtcaatattccaaaggttcttcgt
gctgctgaacaagctcatttatggtcagagttagtatttctttatgataagtatgaagag
tatgataatgcgattcttacaatgatgagtcatccaactgaaggatggagagagaatcat
ttcaaagacttaataacacgggttgctaacgtagaattatattataaagctatccaattc
tacttgacttacaaaccgctgcttctaaatgacttactcatggtcttatcacctcgtttg
gatcatacacgtgcagtaaatttcttcatcaaggcaggacatattgctctagttaaaccc
tatttgcggttcgttcaacaaaataatgcaaataataaatcagtgaatgaggctttaaac
gacttgttaatcgaagaagaagattatcaagctttaaggcaatctattgaaactcatagt
aactttgatcatattgcgttggctcaacagttagagcgtcatgaactcattgagtttcgt
cgccttgccgctttattgtttaaaggtagtaatcggtggatgcaaagtatcgacctttgt
aaacgtgatcagttgtattctgacgccatgcaatatgcctgggattctcgggatcctgag
acagctgaggaattgcttcgttggttcctttccgaaaatctacccgactgtttcgcagct
tgtctttaccgttgttacgatctcctgcgtccagatgttgtcttggaacttgcttggcgc
aatggacttattgacatggctatgccattcttaattcaaactttgagagagttaacaaca
aaagtggatcgtctagaacgctctgaacaaactcgtgctgctgaagaggagaaagctgaa
caggcagttaatccgctagtgatgcgaactgaacctcagttaatgttaccgggaccagca
ggatctatgccagcagccttaatcccaccaacgggcgcaccgattggaatgttcggagtt
actggcccacaaatgtattatcaaacaaacggaccatctttttaa

DBGET integrated database retrieval system