KEGG   Schistosoma mansoni: Smp_154420.1Help
Entry
Smp_154420.1      CDS       T01095                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
smm  Schistosoma mansoni
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:smm00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Smp_154420.1
   04142 Lysosome
    Smp_154420.1
Exosome [BR:smm04147]
 Exosomal proteins
  Proteins found in most exosomes
   Smp_154420.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 1334 aa AA seqDB search
MASRCNLPGAEDLFFKKFDSLFQSGQFPEAAKLAANAPKGILRTPQTIQRFQQVSSAPGQ
ASALLQYFGILLDQGQLNKFESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKQA
DPTLALSVYLRANVPPKVVQCFAETGQFQKIIVYAKKVGYTPDYIFLLRNLTRINPDQGL
QFAQMLVQDQEPLVDLEQVVNVFMDQGLVQQCTSFLLDALKHNRPSEGHLQTRLLEMNLM
SAPQVADAILGNQMFSHYDRAAIAQLCEKAGLLQRALEHYTDLYDIKRAVVSTHLLNPEW
LVNYFGSLSVDDSLECLRAMLQTNIRQNLQVCVQIATKYHEQLGTNALIEIFESFKSFEG
LFYFLGSIVNFSQEPEVHFKYIQAACKTGQVKEVERICRESNCYEPERVKNFLKEAKLTD
QLPLIIVCDRFDFVHDLVLYLFRNNLQKYIEIYVQKVNPARLPVVVGGLLDVDCSEDIIK
QLMAVVRGQFNTDELVAEVEKRNRLKLLLPWLESRVHEGSVEPATHNALAKIYIDLNNNP
ERFLRENQYYNSSVVGKYCEKRDPHLACIAYERGHCDQDLIRVCNENALFKTEARYLVRR
KEPELWAEALSESNSYRRQLIDQVVQTALSETQDPEEISVSVKAFMAADMPNELIELLEK
IVLDNSVFSDHRNLQNLLILTAIKADKSRVMEYINRLDNYDAPDVANIAINNSLFEEAFA
IFKKFEVNTSAIQVLIDHVKNFDRAYEFAERCNEPAVWSLLAHAQLAQGSIKEAIDSYVK
ASDPSRFQAVSEAASNSGNWEDLVRYLQMARKKARETFIESELAFAYARTNRLSDLEEFI
SGPNHANITVVADRCFDQQLYEAAKILYSNVSNYSRLAITLVHLGEYQGSVDAARKANST
RTWKEVCFACVNHKEFRLAQMCGLHIVVHADELGDLINYYEQRGHFDELIQLLEAGLGLE
RAHMGMFTELAILYSKFKPEKMREHLELFWSRVNIPKVLRAAEQAHLWSELVFLYDKYEE
YDNAILTMMSHPTEGWRENHFKDLITRVANVELYYKAIQFYLTYKPLLLNDLLMVLSPRL
DHTRAVNFFIKAGHIALVKPYLRFVQQNNANNKSVNEALNDLLIEEEDYQALRQSIETHS
NFDHIALAQQLERHELIEFRRLAALLFKGSNRWMQSIDLCKRDQLYSDAMQYAWDSRDPE
TAEELLRWFLSENLPDCFAACLYRCYDLLRPDVVLELAWRNGLIDMAMPFLIQTLRELTT
KVDRLERSEQTRAAEEEKAEQAVNPLVMRTEPQLMLPGPAGSMPAALIPPTGAPIGMFGV
TGPQMYYQTNGPSF
NT seq 4005 nt NT seq  +upstreamnt  +downstreamnt
atggcttccagatgcaatcttcctggtgcagaagatttgtttttcaagaaattcgattct
ctttttcaatccggtcagtttcccgaagctgcgaagttagcagctaatgctcctaaaggt
attttgcgcactccacagacaattcaacgttttcaacaggtgtcaagtgcaccagggcaa
gcatcagccctgttgcagtattttggaattctacttgaccaaggtcaacttaacaagttc
gaaagtctggagctttgtagaccagttttacaacagggtaggaaacagttgttggaaaaa
tggttgaaggaggacaaattagaatgttcagaggagttaggagatcttgttaagcaggcg
gatcctacactagctttgtcagtctacctaagggccaatgttccaccaaaggtcgtacag
tgttttgctgaaactggccagtttcagaaaatcatcgtttatgcgaagaaggtcggctac
acaccagattatatttttctgttacgcaacctaactcgtatcaacccagaccaaggtttg
cagtttgcccaaatgttggttcaggatcaagaacctttagttgatttagaacaagttgta
aatgtgtttatggatcaaggtttggtgcagcaatgtacatcattcttactggatgcatta
aagcataatcgaccttctgagggacatctccaaactcgtttattagaaatgaatctaatg
tcagcacctcaggttgcggatgcaattttgggcaaccaaatgttttcacattatgatcgg
gcagctattgctcagttgtgtgagaaagcagggttgttgcagcgggctttggagcactat
actgatctttacgacatcaaacgggctgtcgtaagtacacatttgttaaatcctgagtgg
cttgtcaattattttggctcactttctgtcgatgactcgttggagtgtttgagagctatg
ctgcagacaaatattagacaaaatctccaggtctgtgtccagattgctactaagtatcac
gaacagttggggacgaatgcgcttatcgaaatttttgaatccttcaaatcatttgaaggc
ctgttttactttttggggtctattgttaattttagtcaagaacctgaagttcattttaaa
tatattcaagctgcctgtaaaaccggacaagtcaaagaagttgaacggatttgtcgcgaa
agcaattgttatgaaccagaacgagttaaaaattttcttaaagaggcaaaacttacggac
caattacctcttattattgtctgcgatcgcttcgattttgttcatgatctcgtcctttat
ttgtttcgtaataatttgcagaaatacattgagatttatgtgcaaaaagttaatccagcc
cgtttaccggtagtcgttggaggccttttagatgttgattgttcagaggacataataaag
cagttgatggcagttgttcgtggtcagttcaatactgatgaacttgttgcagaagtggaa
aagcgcaatcggctgaagttattactgccatggcttgaatcacgtgtacatgaaggatct
gttgaacctgctacacataatgccctagcaaagatttacatagaccttaacaacaatcct
gaacgtttcttgagagaaaatcagtattataatagctctgttgtcggtaaatactgtgaa
aagcgtgatccacatttagcgtgtattgcatatgaacgtgggcattgtgaccaagatcta
atcagagtttgtaatgaaaacgcattattcaaaactgaagctcgttacttagttagacgg
aaagaaccggagctatgggcagaagctttaagtgaatctaatagttaccgtcgacaatta
attgatcaagttgttcagacagcactttctgagacccaagatcctgaagagatatccgtt
tctgttaaagcatttatggctgcggatatgccgaatgaacttattgaacttctggagaaa
atagttctggacaactcagtattttctgatcatcgcaaccttcaaaaccttttaatccta
actgcaattaaggctgataaaagtcgtgtcatggaatacattaatcgtttggataattat
gatgctcctgatgttgctaacatagccataaataattctctttttgaagaagcatttgcc
attttcaagaaatttgaagtcaacacatccgctatacaggttttgattgaccatgtcaaa
aattttgatagggcctatgaatttgctgaacgttgtaatgagccagctgtttggagtctt
ctagcacatgctcagttagctcaaggttccataaaagaagccatcgactcatacgtgaag
gcgtctgatcctagtcgattccaagcggtctccgaagctgcttcaaactctggaaattgg
gaagatttagttcgttatctccaaatggcacgaaagaaagcccgtgagacgtttattgag
tcagagcttgccttcgcctatgcaaggactaatcgtttgtcagatctcgaagagttcatt
tcagggccaaatcatgccaatataactgttgtagccgatcgttgttttgaccaacagcta
tacgaggcagctaagatattatattcaaacgttagcaactattcccgcctagcaataact
ttggttcacttaggtgagtatcaaggatctgtggatgctgctcgaaaagcaaattcaaca
cgcacttggaaagaagtatgtttcgcttgtgtaaatcacaaggaatttcgtttggctcaa
atgtgcggtctacatattgttgtacatgcagatgaattaggcgatcttattaattactat
gaacaacgcggtcactttgatgaacttattcaacttttagaagctggtttaggtttggaa
cgggcacatatgggaatgttcactgagctggcaatattgtattcaaagtttaagccggag
aaaatgcgggaacatttggagcttttctggtctcgtgtcaatattccaaaggttcttcgt
gctgctgaacaagctcatttatggtcagagttagtatttctttatgataagtatgaagag
tatgataatgcgattcttacaatgatgagtcatccaactgaaggatggagagagaatcat
ttcaaagacttaataacacgggttgctaacgtagaattatattataaagctatccaattc
tacttgacttacaaaccgctgcttctaaatgacttactcatggtcttatcacctcgtttg
gatcatacacgtgcagtaaatttcttcatcaaggcaggacatattgctctagttaaaccc
tatttgcggttcgttcaacaaaataatgcaaataataaatcagtgaatgaggctttaaac
gacttgttaatcgaagaagaagattatcaagctttaaggcaatctattgaaactcatagt
aactttgatcatattgcgttggctcaacagttagagcgtcatgaactcattgagtttcgt
cgccttgccgctttattgtttaaaggtagtaatcggtggatgcaaagtatcgacctttgt
aaacgtgatcagttgtattctgacgccatgcaatatgcctgggattctcgggatcctgag
acagctgaggaattgcttcgttggttcctttccgaaaatctacccgactgtttcgcagct
tgtctttaccgttgttacgatctcctgcgtccagatgttgtcttggaacttgcttggcgc
aatggacttattgacatggctatgccattcttaattcaaactttgagagagttaacaaca
aaagtggatcgtctagaacgctctgaacaaactcgtgctgctgaagaggagaaagctgaa
caggcagttaatccgctagtgatgcgaactgaacctcagttaatgttaccgggaccagca
ggatctatgccagcagccttaatcccaccaacgggcgcaccgattggaatgttcggagtt
actggcccacaaatgtattatcaaacaaacggaccatctttttaa

DBGET integrated database retrieval system