KEGG   Schistosoma mansoni: Smp_155750.1Help
Entry
Smp_155750.1      CDS       T01095                                 

Definition
bile acid beta-glucosidase-related
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
smm  Schistosoma mansoni
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Smp_155750.1
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Smp_155750.1
Enzymes [BR:smm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Smp_155750.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 892 aa AA seqDB search
MDEQQVSVLEVIRKLGIVPVYGWEARFDHKCKIKCRPFTVPRASQMRDILGMSLRLVTKH
TTFSKLRAVFSKRFFYIKKRFIQHRLPFIDAVSHVPWRPIYGVPIGGIGSGSIGRGYRGE
FCRSSLIPGMYSYDVQPVDQFIVTVRKNGVTVYHQVLSPLTKPPSNAKKLKKWKWGFDPE
KGHYLGLYPRSWTVYEIPELQLVLVYQQISPVIPHDYQTTCLPVAVFYWKVISWNKENLK
VTITFSWHGPNHRKRTKSSDFSKSEDGNNSSENTTNTHVSTAENAFPTCSQRSTAFSTGD
FLKLNCQGKKLKTFTDLSWLGWLVGYTVPLDSKAKKSPKLAIAVSATTNVPRCNITDNLN
PSQSELEFAITWHSPIVKFRTGDVVYTRRYVRWFPVDRISGAKLLLAHAIDNWRQWVQKI
EDWQNPILSNQSLPSWYKSALFNELYYLSDGGTVWLDPIQVDLTEDMKVDSWDHRARLSR
EIGLFGYLEGHEYRMYNTYDVHHYASWALIKLWPKIQLALNYDCADLTIAEDSTSVYYIG
NGKALFRSSECAVVHDFGDPEDEPWRCTNAYIMFPTDTWKDLNSKFILQVWRDWRITQDH
QYLLYMLPIVLRILRKSLVAWDSDDDGLIENSGFPDQTYDVWTAKGLTAYTGGMWLSCLY
ATFDMLSWCLKSDSPVYDQIVNNTDDTQRSWSEIKDEVQTLFTKARDSYNAKLWTGSYYA
FQTYCTPRREVIMADQLSGYWFSRITGVPPNLILPKNHVVKTLQTISNCNWHGIKNGTIG
AINGCLPVCKPDLSSVQAEEFWVAVNYSLSSLMIAEGMIDEGLALGEKCYDTIYNLYGLQ
YQTPEAYMSDGRFRCPGYMRALAIWSIQQALEFTNIYKYSDASEFNATFTNI
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggatgaacagcaagtttctgttttggaggtaattagaaagcttggcatagtacctgtc
tacggatgggaagctcgctttgatcataaatgcaagataaaatgccgtccttttaccgtg
ccacgggcttcgcaaatgagggatattctgggaatgtctcttcggttagttactaaacat
accactttttcaaaattgcgtgctgtttttagtaaacgttttttttacataaagaagcgt
tttattcagcaccggttgccctttattgatgctgtttctcacgtgccatggagacctata
tatggcgtaccgattggaggcattggtagtggttctatcgggcgtggatatcgtggggag
ttttgtcgttcaagcctgataccaggtatgtacagttacgacgtacaacctgttgatcaa
ttcatcgtaacagtcagaaaaaatggtgttactgtttatcaccaagttctgtcaccgtta
acgaaacctccatcaaatgccaagaaattaaaaaagtggaaatggggttttgatccagaa
aaaggtcattaccttggtttatatcctagatcatggacagtttatgaaatacctgaactt
caacttgtattagtttaccaacagatatcccccgttataccgcatgactatcagacaaca
tgtcttccggttgctgtattttattggaaagtcataagctggaataaagaaaatttgaaa
gttactatcacattttcatggcatggcccgaatcatcgtaaacgaactaaatcaagtgat
ttttccaaatctgaggacgggaataatagtagtgaaaacactacaaatactcatgtttct
actgcggaaaatgctttcccaacttgctctcaacgatccactgctttttctactggagac
tttttaaaattgaattgtcaggggaaaaagttaaaaacattcactgatctgtcgtggttg
gggtggctagttggttataccgtgccacttgattctaaagccaagaaatcacccaaacta
gctatagctgtaagtgccacaactaacgtaccccgatgcaacatcactgataatcttaat
cctagtcaaagcgaacttgaatttgccatcacctggcattctccaatagtaaaatttcga
acaggtgacgttgtttatactcgtcgatatgttcgttggtttcctgttgacagaatatct
ggagctaaattgttactagcccatgcaatagataattggaggcaatgggtccagaaaatt
gaggattggcaaaatcctatcctcagtaatcaatcgctcccaagttggtataagtctgct
ttattcaatgaattatattatcttagtgatggtggtactgtatggctagatccaatccaa
gttgatttaactgaagatatgaaagtcgactcttgggatcatcgtgctagattatcacgt
gaaataggtttatttggatatcttgaaggtcatgaatatcgaatgtacaatacatacgat
gtacatcattatgcatcatgggctttaataaaattatggcctaaaatacaactggcttta
aattatgattgtgccgatttgactatagctgaagattcaacttcagtctattacattggt
aatgggaaagcgttattcagaagttccgaatgtgcagttgttcacgattttggtgatccg
gaagatgaaccttggcgatgtaccaacgcctacataatgtttcctactgatacatggaaa
gatttgaattcgaaattcattttacaagtttggcgtgattggcgtattacacaagaccat
caatatttattatatatgcttccgattgttttgagaattctgagaaagtcgttggtagca
tgggattctgatgatgacggactaattgagaattcaggttttcctgatcaaacatatgac
gtatggactgcaaaaggcctgactgcttacactggtggcatgtggctctcttgtctatat
gctacatttgatatgctctcttggtgtttaaaaagtgattcacctgtatatgatcaaata
gttaataatacagatgatactcaacgttcttggagtgaaattaaagatgaagttcaaaca
ctattcactaaagcacgcgattcatacaatgccaaactatggacaggttcgtattacgct
ttccaaacatactgtactcctagacgtgaagttattatggccgatcaattaagcggatat
tggttttcccgtattactggagtgccaccgaacttgattttacccaaaaatcatgtagtg
aaaaccctacagacaatttcgaattgcaattggcatggcataaaaaatggcactataggt
gcaattaacggttgtcttccagtctgtaaacctgaccttagtagtgttcaagcagaagaa
ttttgggtcgctgtaaactactcactttcttctcttatgatagccgagggaatgattgac
gaggggttggctctcggcgaaaaatgctacgacactatctacaatctttacggattacaa
taccagacacctgaagcatacatgtctgatggtcgttttcgttgtcctggatatatgcgg
gcactggctatttggagtattcaacaggcattagaattcaccaacatatacaagtactca
gacgcttcagaatttaatgctacatttacaaacatttag

DBGET integrated database retrieval system