KEGG   Schistosoma mansoni: Smp_157100Help
Entry
Smp_157100        CDS       T01095                                 

Definition
sphingoid long chain base kinase
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
smm  Schistosoma mansoni
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Smp_157100
Enzymes [BR:smm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     Smp_157100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 424 aa AA seqDB search
MRCTLYLNELGICVVPNHYSLPNKMYIHKNLIIGCKKEIILKNKKKQNVCLKMSYFKTRK
VNGKKENLKILEETNLDILFSSDQEASECMKAMEFFVENAHLSDAKPYLVLINPKSGSGN
ALNGFNYKVSPIWKQMNVPYELFCTEYPGHAENFIINLPKANLLRYRAIVTCSGDGLVYE
VINGLISRKDYDDVIEEDTIPIGILPRGSANSTAASICYHSGCTLPVLPRIPPVSCTHFA
TYHTNYHRFGIQSIEWGFIADVDYKKKPTYRAKLSYLPFDNVLYQKNKYKNDELVQKSSV
SSTECENSSDLTDKLNESPQQIKKSHQSWSFLPETNQHISNHQDKWVTLDKKFVTILVLN
HSHITSSAVMYPDAHMSDPYLNLLILHENTTREEKGSYHRIHTLNVYDNIKYVTGTKLTV
YIYE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgtacactttatctaaacgaacttggaatatgtgtcgtgccaaatcactattct
ttacccaacaaaatgtatattcacaagaacctaataattgggtgcaagaaagaaattata
ttaaaaaataagaaaaagcaaaatgtttgcctaaaaatgagttattttaaaacaagaaaa
gtgaatggaaagaaagaaaatttgaaaattcttgaagaaacaaatcttgatatacttttt
tcatctgatcaagaagcttctgaatgcatgaaagcaatggaatttttcgtcgaaaatgcc
cacttaagcgatgccaaaccatatttagtcttaataaaccctaaaagtggatcaggaaat
gctctaaatggttttaactataaagtttctcccatttggaaacaaatgaatgttccatat
gaattattttgtacagaatatccaggtcatgcagaaaattttatcataaatttaccaaaa
gctaatcttttacgttaccgtgcaattgttacgtgttcaggcgatggactagtgtatgaa
gtaattaacggactcatttcaagaaaagattatgatgacgtaattgaggaggatacaata
cctattggtattctaccaagaggcagtgctaattcaactgctgcttcaatttgttaccat
tctggttgtactttaccagttcttcctcgtattcctcctgtgagttgtacacactttgca
acatatcacacaaattatcatcgattcggtattcaaagtattgaatggggtttcattgct
gatgtagactacaaaaagaaaccaacatatcgtgccaaattatcatacttaccatttgac
aatgtactatatcaaaaaaataagtataaaaatgatgaactggttcaaaaatcttctgta
tcatcaacagaatgtgaaaattcaagtgatttaacagataaattaaatgaatcccctcaa
cagatcaaaaaatcgcatcaatcctggtcatttctaccagaaactaatcaacatatttct
aatcaccaagacaaatgggtcactttagacaaaaagttcgttacaatattagtattaaat
cactctcatataacatctagtgctgtaatgtatccagatgctcatatgagtgacccatat
ttaaatttattaattctgcatgaaaacacaacaagagaagagaaaggcagttaccataga
attcatacactaaatgtatatgataatataaaatatgtcactggaacaaaacttactgta
tacatttacgaataa

DBGET integrated database retrieval system