KEGG   Schistosoma mansoni: Smp_157100Help
Entry
Smp_157100        CDS       T01095                                 

Definition
sphingoid long chain base kinase
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
smm  Schistosoma mansoni
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:smm00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 424 aa AA seqDB search
MRCTLYLNELGICVVPNHYSLPNKMYIHKNLIIGCKKEIILKNKKKQNVCLKMSYFKTRK
VNGKKENLKILEETNLDILFSSDQEASECMKAMEFFVENAHLSDAKPYLVLINPKSGSGN
ALNGFNYKVSPIWKQMNVPYELFCTEYPGHAENFIINLPKANLLRYRAIVTCSGDGLVYE
VINGLISRKDYDDVIEEDTIPIGILPRGSANSTAASICYHSGCTLPVLPRIPPVSCTHFA
TYHTNYHRFGIQSIEWGFIADVDYKKKPTYRAKLSYLPFDNVLYQKNKYKNDELVQKSSV
SSTECENSSDLTDKLNESPQQIKKSHQSWSFLPETNQHISNHQDKWVTLDKKFVTILVLN
HSHITSSAVMYPDAHMSDPYLNLLILHENTTREEKGSYHRIHTLNVYDNIKYVTGTKLTV
YIYE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgtacactttatctaaacgaacttggaatatgtgtcgtgccaaatcactattct
ttacccaacaaaatgtatattcacaagaacctaataattgggtgcaagaaagaaattata
ttaaaaaataagaaaaagcaaaatgtttgcctaaaaatgagttattttaaaacaagaaaa
gtgaatggaaagaaagaaaatttgaaaattcttgaagaaacaaatcttgatatacttttt
tcatctgatcaagaagcttctgaatgcatgaaagcaatggaatttttcgtcgaaaatgcc
cacttaagcgatgccaaaccatatttagtcttaataaaccctaaaagtggatcaggaaat
gctctaaatggttttaactataaagtttctcccatttggaaacaaatgaatgttccatat
gaattattttgtacagaatatccaggtcatgcagaaaattttatcataaatttaccaaaa
gctaatcttttacgttaccgtgcaattgttacgtgttcaggcgatggactagtgtatgaa
gtaattaacggactcatttcaagaaaagattatgatgacgtaattgaggaggatacaata
cctattggtattctaccaagaggcagtgctaattcaactgctgcttcaatttgttaccat
tctggttgtactttaccagttcttcctcgtattcctcctgtgagttgtacacactttgca
acatatcacacaaattatcatcgattcggtattcaaagtattgaatggggtttcattgct
gatgtagactacaaaaagaaaccaacatatcgtgccaaattatcatacttaccatttgac
aatgtactatatcaaaaaaataagtataaaaatgatgaactggttcaaaaatcttctgta
tcatcaacagaatgtgaaaattcaagtgatttaacagataaattaaatgaatcccctcaa
cagatcaaaaaatcgcatcaatcctggtcatttctaccagaaactaatcaacatatttct
aatcaccaagacaaatgggtcactttagacaaaaagttcgttacaatattagtattaaat
cactctcatataacatctagtgctgtaatgtatccagatgctcatatgagtgacccatat
ttaaatttattaattctgcatgaaaacacaacaagagaagagaaaggcagttaccataga
attcatacactaaatgtatatgataatataaaatatgtcactggaacaaaacttactgta
tacatttacgaataa

DBGET integrated database retrieval system