KEGG   Schistosoma mansoni: Smp_159000Help
Entry
Smp_159000        CDS       T01095                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
smm  Schistosoma mansoni
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:smm00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Smp_159000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 1610 aa AA seqDB search
MFLDSDTENDVMQDTVVAFTSRHLTEAIEGQVLYREKYHKEKIKTLTVALVICLNIDIDP
PDVQKIPPFSRVEAWVDPTDANSLHALGNIGKNLQAQYERWQPRARYKQCLDPTLDDVKK
LCLSLRRNAKDDRILFHYNGHGVPRPTENGEIWVFNTKFTKYIPLSLYDLQRWLGAPTVY
VLDCQNAGRIIHMYEVFCERRKAEAAVVEQRQMECDGKTDQSETSQYNHQSYSGSNCPNI
PNQATLPSSSTVHVVSMENTFMLAACGKDEDLPQNPNLPADLFTACLTTPIRMALRWHWL
RHQEYFPGYLDETLLDRIPGSHSNRMSLLGEINWIFTAVTDTIAWCSFPLDIFQKLFRQD
LLIASLFRNFLLAERIMKYYGCHPISAPLLLPTYKHNMWDAWDHTVDRVIHYLPKMLKII
EGGSFGPSSFFTSQMTAFKIWLQTADERRPVATQLPILLQILLSQSHRIRAMQLLSEFLD
LGPWAVAHCLTVGIFPYIVRLFHSPVSEVKPYLVFIWGKIIASAQTEFGRNDSVRDFGYK
YFIACLSDTENLTPLTRTITAFALAKMLEKDESEEPDPFFQDVYLKQNFLPFVQTQLFDN
TPTDNEEMLIRMRLWLILALAKLWCKNDEARWFGIRHNLPEVLLAYLNDISPEVRAATVY
ALGNLIENQTTDSSKQNHADQISHEIGGQLVKYSSRDACPLVRCMVVEAFRGLIKQFESQ
LCAIGIVTPPGGSGNGGSGGLHISRQLELTSNHINVHGSWFLRKSSNREVDPQHNYNYKT
HLINTQSQASPILRKSVFNPGSVFFTGIVTPPGGSGNGGSGSLHISRQLELTSNHINVHG
SWFLTKSSNREVDPQHNYNYKTHLINTQSQASPILRKSVFNPGSAEFQAIVYNSPNNNDN
NHKFITNDDTTLIPSLNTSLSALNASFTSSNTSTDNVSSTVNELNRAADNINSSRSENTF
VKESSSNSITPITTTSGLQMTTTNPSSSSLIHSAQFPGRRYQQTDQRLRVSVTNSPQLPN
TIMSNNTVTCGVPATTTTDNSGNNGNYPSSLDTVHTQFFAWSCRWFTRPLLSKYGQLNNG
QSKSQTTSKNSFDYEPVSLGTISTDPKAVAYTDRVNRLKKQRKISHLGRLQWERIAGQIS
HSLVTSTINANTTTTTINRIISVYDCCLHPVAFYHHPLNHRINNSSNDTFCSISSQVKFH
PYQPHLVMINSDRKGVVIHSTKNLKLLHSINTFSAKSSLFPEFPSTIDGYSRVGCVTDIE
FINADEEESLLLTATDDGYIRIWRNYTHHLGQDPEILTAWNGITDLYQTDYPVGVVVHWS
QHANQLMVSGDTRIIRIWDCLCESKLRDISTGSDTSVTCLTKSIDNHLLAAGFNDGGIRV
WDKVTPRDCLRSTMSNVVKIPIEYIRLPQDCSIILIFNSQADTARIFKVVFSSTNRLYAV
GAMGGIGAWHLSFPNENNNTTTPTTTTSNTSLLTTSLNSSNNGSSTRHDHNNLTNHPCRY
ISTVIRSSTNNSINNSSTTRRFRRLPCPPRLSLPMNSSVNCADLLVNLSSPHAHLALTGI
RGQSSISLHRIQDGSLHSSIKNFNNTTTNNNTFGREQFGTPVCCAFHPNE
NT seq 4830 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgactcggatacagaaaatgatgttatgcaagacacagtagttgctttcact
tcacgacacttgacagaagcgattgaagggcaggtgttatatcgggaaaaatatcacaag
gaaaagattaaaactttaacagttgctctggttatttgcctaaacattgatattgaccct
ccggatgtacaaaaaattccacctttctctagagtagaagcatgggtcgacccaaccgat
gctaacagtctacacgctctcgggaatatcggtaaaaatcttcaggcccagtacgaacga
tggcaacctcgtgccagatataaacagtgccttgatccaactttagatgatgtgaaaaaa
ttgtgccttagtttaagacgtaacgcaaaagacgataggattctatttcattataatgga
catggtgtccctagacccaccgagaatggggaaatatgggttttcaacacgaaatttact
aaatacataccattatcattatatgatctacaaagatggttaggtgctccaactgtttac
gtattagattgtcaaaatgctggaagaataatacacatgtatgaagttttctgtgaacgt
cgaaaagctgaagcagctgtagttgaacaaagacaaatggaatgcgatggaaaaactgat
caatcagaaacatctcaatacaatcatcaatcatattctggatcgaattgtccaaatatt
cctaatcaagccacattaccatcatcctctactgttcatgttgtcagtatggaaaataca
tttatgttggctgcatgtggtaaagatgaagatttaccacagaatccaaatcttccagca
gatttatttactgcttgtttaactacaccaattcgtatggcacttcgctggcattggtta
cgtcatcaagaatattttcccggttatttagatgaaactttattagatcgtatacctggt
tcccattcaaatcgtatgtcattacttggtgaaattaattggatatttactgctgtcact
gatacaatagcatggtgtagttttccattggatatatttcaaaaattatttcgtcaagat
ttactaattgctagtttatttagaaatttcttactggctgaacgtattatgaaatattat
ggatgtcatccaatatccgctccattattattaccaacttataagcataatatgtgggat
gcatgggatcatactgtagatcgtgtaatacattatctaccaaaaatgttaaaaatcatt
gaaggtggtagctttggtccatcgtcatttttcactagtcaaatgactgcattcaaaatc
tggttacaaacagctgatgaacgacgtcctgtagctacacaattaccaattttattacag
attttactaagtcaaagtcatcgaatacgtgcaatgcaattacttagtgaatttcttgat
ttaggaccatgggcagtagcgcattgtttaactgttggaatatttccttatattgttcgt
ttatttcattcaccagtttcagaagtgaaaccatatttagtatttatatggggtaaaatt
attgccagtgcacaaactgaattcggtcgaaatgattcagttcgtgatttcggttataaa
tatttcattgcttgcttaagtgatactgaaaatcttactcctcttactagaacaatcaca
gcatttgcattggctaaaatgttagaaaaagatgaatctgaagagcctgatccatttttt
caagatgtttatttaaaacaaaattttttaccatttgtacaaacacaattatttgataat
acaccaacagataatgaagaaatgcttatacgtatgagattatggcttatacttgcatta
gctaaattatggtgtaaaaatgatgaagcacgatggtttggtatacgacataatttacca
gaagtacttttggcttatttaaatgatatttctccagaagttcgagctgcaacagtttat
gctcttggcaacctcattgaaaatcaaactactgattcatcgaaacaaaatcatgcagat
caaataagtcatgaaattggtggtcaattagttaaatattcatcacgtgatgcttgtcca
ttagtacgttgtatggttgttgaagcatttcgtggtttaattaaacaattcgaatcacaa
ttatgcgctattggtatagttactccaccaggaggttcagggaacggtggaagcggaggt
ctacatatatctcgtcaattagaattaacttcaaatcatatcaatgtacatggtagttgg
tttttaagaaaatcatcaaatcgagaagttgatccacaacataattacaattataaaact
catttaatcaatacacaatcacaagcttctccaattttacgcaaatctgttttcaatcct
ggttcagtgttttttactggtatagttactccaccaggaggttcagggaacggtggaagc
ggaagtctacatatatctcgtcaattagagttaacttcaaatcatatcaatgtacatggt
agttggtttttaacaaaatcatcaaatcgagaagttgatccacaacataattacaattat
aaaactcatttaatcaatacacaatcacaagcttctccaattttacgcaaatctgttttc
aatcctggttcagctgaatttcaggctattgtttacaattcaccaaataataatgataat
aatcacaaatttatcacgaatgatgatacaactttaatcccatcattgaatacatcatta
tctgcattgaatgcatcatttacaagtagtaatacatctacggacaatgtatccagtact
gtaaatgagttgaatcgtgcagctgataacatcaattcaagtcgttcagaaaatactttt
gttaaagaatcaagttctaattccattacaccaattacaactacttctggattacaaatg
acaactacaaatccatcttccagttctcttatacattctgcacaattcccaggtcgacga
tatcaacaaactgatcaacgattacgtgtatctgttacaaattctccacaattgcctaat
acaataatgtcaaataacactgtaacatgtggagttccggctactactactactgataat
agcggtaataatggtaattacccgtcatcactagatactgtacatacacagttttttgct
tggtcttgtcgatggtttactcgtccacttttatctaaatatggacaattgaacaatgga
caatcaaaaagtcaaactacctcaaaaaactccttcgattatgaaccagtctcattgggt
acaatctctactgatccaaaagcagtcgcttatacagatcgtgtaaatcgtttaaagaaa
caacgtaaaatatctcatcttggacgtttacaatgggaacgtattgctggacaaatttca
cattcattagttacatctactataaatgctaatacgacaacaactacaattaatcgaatt
atttctgtttatgattgctgtttacatcctgtggctttttatcatcatcctcttaatcat
cgtattaataatagcagtaatgatactttttgttctatatcaagtcaagtgaaatttcat
ccatatcaaccacatttagtcatgattaattctgatcggaaaggtgttgtaatacattca
acaaaaaatttaaaacttttacattcaattaatacatttagtgcaaaatcatcattattc
cctgagtttccttcaacgatagatgggtattcacgtgttggatgcgtcactgatatcgaa
tttataaacgcagatgaagaggaaagtttgttgttaactgcaacagatgatggttacatt
cgtatatggcgtaattatacacatcatcttggtcaagatcctgaaatcttaactgcttgg
aatggaatcacagatttatatcaaactgattatccagttggtgttgttgttcattggagt
caacatgcaaatcaactcatggtatccggtgatacacgtatcatacgtatatgggattgt
ttatgtgaatcaaaattaagagatattagtacaggatcagatacatcagtgacatgttta
acaaaaagtattgataatcatttattagctgctggattcaatgatggtggtatacgtgta
tgggataaggtaaccccgcgtgattgtctgcgttcaaccatgtccaatgtggtaaagata
cccattgaatacattcgtctaccacaggattgctcgataattcttattttcaatagtcaa
gctgatactgctagaattttcaaagttgttttttcatcaactaatcgattatatgctgtt
ggtgctatgggtggaattggtgcttggcatttatcatttccaaatgagaataataatact
actacccctacaacaaccacttcaaatacttcacttctaacaacttcattgaattctagt
aataatggcagtagtactcgtcatgatcataataatctcacaaatcatccatgtagatat
atatccacagtgattagatcatcaacaaataatagtattaataattcttcaacaactcga
cgatttcgacgtttaccttgtccaccacgtttatctttaccaatgaattcatcggttaat
tgtgctgatttattggttaatctatcatcaccacatgcacatctagcattaactggtatt
cgtggtcaatcaagtatttcattacatcgtattcaagatggtagtttacattcttctatc
aaaaattttaataatactactactaataataatactttcggtcgtgaacaatttggaact
cctgtttgttgtgcgtttcatccaaatgag

  All links  
No link information was found.   
DBGET integrated database retrieval system