KEGG   Schistosoma mansoni: Smp_159000Help
Entry
Smp_159000        CDS       T01095                                 

Definition
(RefSeq) hypothetical protein
  KO
K07204  
regulatory associated protein of mTOR
Organism
smm  Schistosoma mansoni
Pathway
Autophagy - other
Autophagy - animal
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:smm00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Smp_159000
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Smp_159000
   04136 Autophagy - other eukaryotes
    Smp_159000
Membrane trafficking [BR:smm04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    Smp_159000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
GeneDB: 
UniProt: 
Position
Unknown
AA seq 1479 aa AA seqDB search
MFLDSDTENDVMQDTVVAFTSRHLTEAIEGQVLYREKYHKEKIKTLTVALVICLNIDIDP
PDVQKIPPFSRVEAWVDPTDANSLHALGNIGKNLQAQYERWQPRARYKQCLDPTLDDVKK
LCLSLRRNAKDDRILFHYNGHGVPRPTENGEIWVFNTKFTKYIPLSLYDLQRWLGAPTVY
VLDCQNAGRIIHMYEVFCERRKAEAAVVEQRQMECDGKTDQSETSQYNHQSYSGSNCPNI
PNQATLPSSSTVHVVSMENTFMLAACGKDEDLPQNPNLPADLFTACLTTPIRMALRWHWL
RHQEYFPGYLDETLLDRIPGSHSNRMSLLGEINWIFTAVTDTIAWCSFPLDIFQKLFRQD
LLIASLFRNFLLAERIMKYYGCHPISAPLLLPTYKHNMWDAWDHTVDRVIHYLPKMLKII
EGGSFGPSSFFTSQMTAFKIWLQTADERRPVATQLPILLQILLSQSHRIRAMQLLSEFLD
LGPWAVAHCLTVGIFPYIVRLFHSPVSEVKPYLVFIWGKIIASAQTEFGRNDSVRDFGYK
YFIACLSDTENLTPLTRTITAFALAKMLEKDESEEPDPFFQDVYLKQNFLPFVQTQLFDN
TPTDNEEMLIRMRLWLILALAKLWCKNDEARWFGIRHNLPEVLLAYLNDISPEVRAATVY
ALGNLIENQTTDSSKQNHADQISHEIGGQLVKYSSRDACPLVRCMVVEAFRGLIKQFESQ
LCAIGIVTPPGGSGNGGSGSLHISRQLELTSNHINVHGSWFLTKSSNREVDPQHNYNYKT
HLINTQSQASPILRKSVFNPGSAEFQAIVYNSPNNNDNNHKFITNDDTTLIPSLNTSLSA
LNASFTSSNTSTDNVSSTVNELNRAADNINSSRSENTFVKESSSNSITPITTTSGLQMTT
TNPSSSSLIHSAQFPGRRYQQTDQRLRVSVTNSPQLPNTIMSNNTVTCGVPATTTTDNSG
NNGNYPSSLDTVHTQFFAWSCRWFTRPLLSKYGQLNNGQSKSQTTSKNSFDYEPVSLGTI
STDPKAVAYTDRVNRLKKQRKISHLGRLQWERIAGQISHSLVTSTINANTTTTTINRIIS
VYDCCLHPVAFYHHPLNHRINNSSNDTFCSISSQVKFHPYQPHLVMINSDRKGVVIHSTK
NLKLLHSINTFSAKSSLFPEFPSTIDGYSRVGCVTDIEFINADEEESLLLTATDDGYIRI
WRNYTHHLGQDPEILTAWNGITDLYQTDYPVGVVVHWSQHANQLMVSGDTRIIRIWDCLC
ESKLRDISTGSDTSVTCLTKSIDNHLLAAGFNDGGIRVWDKVTPRDCLRSTMSNVVKIPI
EYIRLPQDCSIILIFNSQADTARIFKVVFSSTNRLYAVGAMGGIGAWHLSFPNENNNTTT
PTTTTSNTSLLTTSLNSSNNGSSTRHDHNNLTNHPCRYISTVIRSSTNNSINNSSTTRRF
RRLPCPPRLSLPMNSSVNCADLLVSCLKIFNIWLSPFLI
NT seq 4440 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgactcggatacagaaaatgatgttatgcaagacacagtagttgctttcact
tcacgacacttgacagaagcgattgaagggcaggtgttatatcgggaaaaatatcacaag
gaaaagattaaaactttaacagttgctctggttatttgcctaaacattgatattgaccct
ccggatgtacaaaaaattccacctttctctagagtagaagcatgggtcgacccaaccgat
gctaacagtctacacgctctcgggaatatcggtaaaaatcttcaggcccagtacgaacga
tggcaacctcgtgccagatataaacagtgccttgatccaactttagatgatgtgaaaaaa
ttgtgccttagtttaagacgtaacgcaaaagacgataggattctatttcattataatgga
catggtgtccctagacccaccgagaatggggaaatatgggttttcaacacgaaatttact
aaatacataccattatcattatatgatctacaaagatggttaggtgctccaactgtttac
gtattagattgtcaaaatgctggaagaataatacacatgtatgaagttttctgtgaacgt
cgaaaagctgaagcagctgtagttgaacaaagacaaatggaatgcgatggaaaaactgat
caatcagaaacatctcaatacaatcatcaatcatattctggatcgaattgtccaaatatt
cctaatcaagccacattaccatcatcctctactgttcatgttgtcagtatggaaaataca
tttatgttggctgcatgtggtaaagatgaagatttaccacagaatccaaatcttccagca
gatttatttactgcttgtttaactacaccaattcgtatggcacttcgctggcattggtta
cgtcatcaagaatattttcccggttatttagatgaaactttattagatcgtatacctggt
tcccattcaaatcgtatgtcattacttggtgaaattaattggatatttactgctgtcact
gatacaatagcatggtgtagttttccattggatatatttcaaaaattatttcgtcaagat
ttactaattgctagtttatttagaaatttcttactggctgaacgtattatgaaatattat
ggatgtcatccaatatccgctccattattattaccaacttataagcataatatgtgggat
gcatgggatcatactgtagatcgtgtaatacattatctaccaaaaatgttaaaaatcatt
gaaggtggtagctttggtccatcgtcatttttcactagtcaaatgactgcattcaaaatc
tggttacaaacagctgatgaacgacgtcctgtagctacacaattaccaattttattacag
attttactaagtcaaagtcatcgaatacgtgcaatgcaattacttagtgaatttcttgat
ttaggaccatgggcagtagcgcattgtttaactgttggaatatttccttatattgttcgt
ttatttcattcaccagtttcagaagtgaaaccatatttagtatttatatggggtaaaatt
attgccagtgcacaaactgaattcggtcgaaatgattcagttcgtgatttcggttataaa
tatttcattgcttgcttaagtgatactgaaaatcttactcctcttactagaacaatcaca
gcatttgcattggctaaaatgttagaaaaagatgaatctgaagagcctgatccatttttt
caagatgtttatttaaaacaaaattttttaccatttgtacaaacacaattatttgataat
acaccaacagataatgaagaaatgcttatacgtatgagattatggcttatacttgcatta
gctaaattatggtgtaaaaatgatgaagcacgatggtttggtatacgacataatttacca
gaagtacttttggcttatttaaatgatatttctccagaagttcgagctgcaacagtttat
gctcttggcaacctcattgaaaatcaaactactgattcatcgaaacaaaatcatgcagat
caaataagtcatgaaattggtggtcaattagttaaatattcatcacgtgatgcttgtcca
ttagtacgttgtatggttgttgaagcatttcgtggtttaattaaacaattcgaatcacaa
ttatgcgctattggtatagttactccaccaggaggttcagggaacggtggaagcggaagt
ctacatatatctcgtcaattagagttaacttcaaatcatatcaatgtacatggtagttgg
tttttaacaaaatcatcaaatcgagaagttgatccacaacataattacaattataaaact
catttaatcaatacacaatcacaagcttctccaattttacgcaaatctgttttcaatcct
ggttcagctgaatttcaggctattgtttacaattcaccaaataataatgataataatcac
aaatttatcacgaatgatgatacaactttaatcccatcattgaatacatcattatctgca
ttgaatgcatcatttacaagtagtaatacatctacggacaatgtatccagtactgtaaat
gagttgaatcgtgcagctgataacatcaattcaagtcgttcagaaaatacttttgttaaa
gaatcaagttctaattccattacaccaattacaactacttctggattacaaatgacaact
acaaatccatcttccagttctcttatacattctgcacaattcccaggtcgacgatatcaa
caaactgatcaacgattacgtgtatctgttacaaattctccacaattgcctaatacaata
atgtcaaataacactgtaacatgtggagttccggctactactactactgataatagcggt
aataatggtaattacccgtcatcactagatactgtacatacacagttttttgcttggtct
tgtcgatggtttactcgtccacttttatctaaatatggacaattgaacaatggacaatca
aaaagtcaaactacctcaaaaaactccttcgattatgaaccagtctcattgggtacaatc
tctactgatccaaaagcagtcgcttatacagatcgtgtaaatcgtttaaagaaacaacgt
aaaatatctcatcttggacgtttacaatgggaacgtattgctggacaaatttcacattca
ttagttacatctactataaatgctaatacgacaacaactacaattaatcgaattatttct
gtttatgattgctgtttacatcctgtggctttttatcatcatcctcttaatcatcgtatt
aataatagcagtaatgatactttttgttctatatcaagtcaagtgaaatttcatccatat
caaccacatttagtcatgattaattctgatcggaaaggtgttgtaatacattcaacaaaa
aatttaaaacttttacattcaattaatacatttagtgcaaaatcatcattattccctgag
tttccttcaacgatagatgggtattcacgtgttggatgcgtcactgatatcgaatttata
aacgcagatgaagaggaaagtttgttgttaactgcaacagatgatggttacattcgtata
tggcgtaattatacacatcatcttggtcaagatcctgaaatcttaactgcttggaatgga
atcacagatttatatcaaactgattatccagttggtgttgttgttcattggagtcaacat
gcaaatcaactcatggtatccggtgatacacgtatcatacgtatatgggattgtttatgt
gaatcaaaattaagagatattagtacaggatcagatacatcagtgacatgtttaacaaaa
agtattgataatcatttattagctgctggattcaatgatggtggtatacgtgtatgggat
aaggtaaccccgcgtgattgtctgcgttcaaccatgtccaatgtggtaaagatacccatt
gaatacattcgtctaccacaggattgctcgataattcttattttcaatagtcaagctgat
actgctagaattttcaaagttgttttttcatcaactaatcgattatatgctgttggtgct
atgggtggaattggtgcttggcatttatcatttccaaatgagaataataatactactacc
cctacaacaaccacttcaaatacttcacttctaacaacttcattgaattctagtaataat
ggcagtagtactcgtcatgatcataataatctcacaaatcatccatgtagatatatatcc
acagtgattagatcatcaacaaataatagtattaataattcttcaacaactcgacgattt
cgacgtttaccttgtccaccacgtttatctttaccaatgaattcatcggttaattgtgct
gatttattggtaagttgtttgaaaatctttaatatttggttgagtccttttctcatttaa

DBGET integrated database retrieval system