KEGG   Schistosoma mansoni: Smp_161010Help
Entry
Smp_161010        CDS       T01095                                 

Definition
mixed-lineage leukemia 5 mll5
Orthology
K09189  
histone-lysine N-methyltransferase MLL5 [EC:2.1.1.43]
Organism
smm  Schistosoma mansoni
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Smp_161010
Enzymes [BR:smm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Smp_161010
Transcription factors [BR:smm03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    Smp_161010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 751 aa AA seqDB search
MCFLNILIVTGGSSSANAGIEGFSSSPPVLDDYDDLSNMRPSYATDLKSCFMEGSLNVCQ
TQGSHPIPVSDKVQIRHSSIVHRLITDCPNNKVQNASTQVNEVCHTSPPCSAPDSVLSPP
SDIYEEAQALHLSSRVCKKLSLMFPLFTGIGADCGDIDGIFNEEIPSNLERLFRYQVVSF
DFNRRGLIANEDICPRTPIIEYRGNCLLLSEYNDMYDYRKHYNPFVLFYKSFPKLPLCVD
ARKYGNEARFIRRSCTPNSEVRHCISFSDDQHNGPVPHLRLIVVASRVIPKSSEITLPFD
FDYTACRYLVKCACVLKGCPITRWFQRMNQLSNPLRSSTRHSLVCTRKLPHSPHSYGVNG
HSRGLSLLQSSQSHYDDKDPSDEQSVLCPKSSVNTNLRNLPVNRTGRYLPSPISNERTSG
SHQIGSNRTTRGYLNKSGISCGVRKAIHRRGRGRGRLRSSSSLGVRSKRETERLSSRIVY
LRKSNSKSLTTARKRRSQRNFYSHSGQHPVSSSSDSIVNVEKKRDLHNFSGKSSCSYEIE
CLDRLQSVPVKASDSPQKSFNRDNQEVIDNTDIGCKSNNELLGEDLDADTEPEYDVQPEK
LTDRSVGRKYVQPNSRQDRLNSKGTKESYTSNNSPRQSDLDYVKAEMHESHISKRKSVDS
SSLVDRRKRRSQISTLDDHFSKSRKRSTSIEQKEDKDFELVSLIEDPSFWSWTLPGFTLR
KSITEASADDVQNGNESSVIKPTQSIQQHPS
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgtgttttttgaatattcttatagtcactggtggatcatcctccgcaaatgcaggcatt
gagggcttttcaagctcacctccggtgttggatgactatgatgacttgtcaaacatgcga
ccatcttatgccactgatttaaagagctgcttcatggagggttcattgaacgtatgccaa
acacaaggaagtcatccaatccctgtgtccgataaagtgcaaattcgtcatagcagcatt
gtacatcgtttaattacagattgcccaaataataaggtacaaaatgcatctactcaggta
aatgaagtgtgccatacctcccctccttgttcagcacctgactctgtactatctcctcca
tcagatatctatgaagaagcccaggctctacatctttcaagccgtgtttgcaaaaaactc
agtttaatgtttcctctgtttactggcataggagcagactgtggcgacatagatggtatt
tttaacgaagaaattccttctaatctcgagcgtttgttccgttatcaggttgttagtttc
gacttcaaccgcaggggcctaatagcaaatgaagacatttgtcctcgtacgccgattatt
gagtaccgtggtaattgtttgttactcagtgaatacaacgatatgtacgactaccgcaaa
cattacaatccgtttgtactgttttacaaatccttcccgaagttacctctctgtgttgat
gctcgcaagtatggcaatgaagcacgctttatccgtcggtcatgtacacctaactctgag
gtccgccactgcatttccttttcagatgatcaacataatggacccgttcctcatcttcgt
ctcatcgttgttgcatcacgggttattccaaagtcatctgaaataactctaccttttgat
tttgactatacagcttgtcggtatcttgttaagtgtgcatgtgttcttaaaggttgtccg
attacccgttggttccaaagaatgaatcagttgagcaaccctttgcgaagttcaactcgc
cattcgttggtatgcactcgcaaattaccacattcaccccactcatatggagtcaacggt
cattctcgtggtcttagtctgttacaaagctcccagtctcattacgatgacaaggatcct
tccgatgaacagtcagttttgtgtcctaaatcttccgtaaacaccaatttgagaaacctc
cctgttaatcgaacaggccgttaccttccaagtcctatttcgaatgagagaacttcagga
tcacatcaaataggatctaaccgaactactcgtggctacttgaataaatcaggcatttca
tgtggagttcgtaaagctattcatcggagaggccgtggacgggggcgattaagaagttct
agttctcttggagtgcgtagcaaacgtgaaacagagcgactgtcttccagaatagtgtac
cttaggaagtccaattcgaaatccttgacaactgccagaaaacgtcgttcacaacgtaat
ttctattctcacagtggtcaacatccagtgtcatcatccagtgatagtattgtaaatgta
gaaaagaaaagagacttgcataacttttctggtaaaagcagttgctcttacgaaatagaa
tgtttagatagattacaatcggttcctgttaaagcaagtgactctccacaaaagtcattc
aacagagacaatcaagaagtcattgataacacagatatcggctgtaaatcgaataatgaa
ttattgggagaggatttagatgctgacactgaaccggaatatgacgtacaaccagaaaag
ttaacagatagatcagtaggtcgaaaatatgtacagcctaactcccgtcaggaccgtctt
aattccaaaggaacaaaagagtcttatacctcaaataattctcctagacaatctgatttg
gactatgtaaaagctgaaatgcacgaaagtcatatttctaagcgcaaatctgttgattcg
tcatcacttgttgaccgtagaaaacggcgttcacagataagtacactcgatgatcatttt
tctaaatcacgtaaaagaagtacttcaattgaacaaaaagaagacaaggattttgagctt
gttagtctaatagaggacccttcattttggtcttggacattaccagggtttactttacgt
aaaagcatcacagaagcaagcgccgacgatgtgcagaacggtaatgagagctctgtaatt
aaaccaactcagagtatccaacaacatccaagctga

DBGET integrated database retrieval system