KEGG   Schistosoma mansoni: Smp_163040Help
Entry
Smp_163040        CDS       T01095                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
smm  Schistosoma mansoni
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:smm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Smp_163040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 2488 aa AA seqDB search
MAELLKKLSLKSLGKNERDYEIVKNANNSAVTLPEFPHKVVLSEDVIQESLFISEVFNFN
ELRAVELCLTVESQLSLFPCLGRGFVAVVLYYESHLSIIDTLVALIGARDGRMWSNPTSA
EICQVIHSFTDELSANGLFPNILGVLRSFSVYKEFSRLENLQVLGDSKHRHDVFMMLKNI
SEGLAECVMLWSCQSVLNLSEFKLVLDCLLSSANQEPSTKNNGNQNELTFQNNGQLTREG
LHLLMSLLHCLQPFSSNTLCADQVSDLTDIDWTHPLYTDRTFAASIGRLLDNQRSLFEQR
SEESDSDRLKLLAFIRLSWALCLRRTSHLRAELRRRQTVDVSRSTPYTVANRKDLATLNE
DFGIGGDEEDELQAALAIESGALEFARKQILNTTDFEREPLWVYRMHCIITDLIVHMAVR
VKEIRLRDEDILRSTGFDPSTTGHGFANFLLLIAQLYNQPGSRLHGRLGLEFWWPVGELT
NIAPVALGSSDLLSPSTADKSPRPKFHTYGSQSRNAELDNIRQAALIRFLRLAGDMVTAP
CLFLPYLRMLHGLCCSRSAAGLCFSLLKANATNPGRGASLITWDHFFNSFRQYLNHMKQV
VVQPEPTNFRLQASNQLYPHLYFNDGVTPRSRVSGFPRSTTESMYGHRKGSSSSDIGATT
VPMNIQPRSIQPEEQAGLQAVLRLVARVCRMDPVARSTFISNPQWQLIPICMGFLTCPVS
LDLKADILYLLTEFCKSQQNIPVIWQHFVSSETDMDEVEPRAEEYPLTNAFLTLITVMLP
KLINYPIPIPSNVLRSGDTKEMGTFGLTSIGHNIPSQTNPFLSITSFITNTIFLRHTMRA
YRNPVERVTGLLEVGLHRHLEFPIPNGPPVSMTRATYAGLSLIRRLLASEDILVTFVRRI
ATNIQPRIGSVHSSSNISIPLPNVPSFGLTILPVYVSRLLMSTNIGSGRADLIPMLLKYC
LLADYLPDHTSCAVSILGYLASSIQPHSDLLALLTADETTRNQLLGAFTYLIKWPMNVDI
NSNLIPMDNNLDNEGHFAFTDEWLYGDNDNNELCLHSVGTFSSRLPSPVINAARYDAAFP
LQTNNWYFPSRIWERCASYLNTYFSEWTDMRITHNRMNNNDYYIQAFGDWFYPVMEHPAP
NLAHWLCGFCVDNCKAISRSNLQDAGIADQQRTCLHSMLDMIDSTTHWLQSITTLPFEFS
CTLQWNLALIWQILYKLGSNPLTSEPLLRFLRGNHDLLAKYLHSDLCQPLLSSSLDGNVC
ENFTDRQKAVIEALSLNRKNWILRLYAIEIRVCAMANQRSYVTRLLKLFLGAPSVLVNFL
QILNTSNELVNDCNPFESKLFNSNVLHELLKKSSINCPLLSSDSNATKVLSTMIHFKIFL
MNLFMKLISTRNDLDSYSNEDLNKLITLTFDQVFDINRSAYHLSILEVFNTSYLSSSSST
TTVSALIKQISDLREWIDHRNIHNLHLYAGKQVAIEAWRQAVEISLGLMTNQGQYDSGNN
NNTVQRSSNQPMISVPSYLYSELISLLRNDGDGDIGIGSNNMSQYKFKLRPVPVLCLDVL
ILLLSQICSVKEVPQTIRLLASGTSLTLCSFFHCQSSYVNASKSNISEMPTSGLDKCVYN
KHWSPLLISVMELLVKSIVRTKTSTQRMRANYYGSLCYVIRFCRDLGQSLKDDKVSLTDF
NSLMECFSIFNYSTTNTNTNLNTIHSNALNSSDLNQLHSTLITDIIHGHTMIQLAAMSLL
ELLISFDRCSQQLITYLDNQGTIQHILDTIIEDLQVIGKFLTSVNTELPDYSSVLNRSNY
LPLESNNNNNHNYPNEDSSSIMSSYLLYQSKMSILCRIGSYPIGAKILANHGIINRLTNC
DVLSLSNLANCYSYGLDCLYICEDDNNNNNQQYQDISHRSNESNQLMDLIWFRSSKFQRY
LSYSSSSSSSSIVGKSDHSIYWDFIESIISSIMIEPGCEIDENELMKINWAGLLIPTLRL
SKILINSLGTTHMSINQQIVNFLHTHSSSLMCNEIQLASSIVTFLSRQDWSYINHSNSSS
SSSTNQPINSNWLIQWIASETNLINLFSLIMPSFNSPVSIMCSDEYSNLQREVIQSKILN
HTFELLINLIHPSNIHSFTDNDLSSIYKFQNNYFAFEYSFIETQYIQLIYSLLFILTGYI
SIPEYRIRKFITDNINNHTTARTLFQYFNHSIIHSEQENSTFNVKIQNTLTLIVNLLQWS
LKCLRSKEKICLALINVQFLNSSSNSRTKEPTKSKIIGEQRNQQQQQFGQSIVQLLNCES
FSENLPINELKQASSIIFKCPLQLLNSVDRITAGKENQNAEIQMMQRLTQLGVSCLRVQL
RGLIVNIFIMETFKQSYKQSYIIIGENNKETPLHHQSLQSSHGVRNLSTTNCITSPMMKS
SLKPLLTPTKRNTLMNTAFSQENNSILQMNMSWLRNHCEHLVQDEIMEMLNQLTKAAYLK
QNQRLFIQVMHNRLERIIQKQLNSNLST
NT seq 7467 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacttctgaagaaactttcgttaaagtctttgggcaaaaatgaacgtgattat
gaaattgttaaaaatgctaacaactcggcagtcacgctacctgaatttccacacaaggtg
gtactgtcggaggatgtaattcaggagtcactgtttattagtgaagttttcaacttcaat
gaacttagagctgtagagctttgcctaacagttgagagtcaactatccttatttccttgt
cttggccgaggttttgtcgccgtagttctctattatgagtctcacctctccattatcgat
acattggttgccttgattggtgctcgtgatggacggatgtggtcgaatcctacatcagct
gagatttgtcaggttatccattcatttaccgacgaactgtctgccaatggattattccca
aatatcttaggtgtcctacgatcattctccgtgtacaaagaattttctcgtttggaaaac
ttgcaggtcttaggtgactcaaagcaccgacatgatgtgtttatgatgttaaaaaatata
tctgaaggtctagctgaatgtgttatgttatggtcgtgtcaaagtgtcctaaacttaagc
gagtttaagttagttttggattgcttactcagttcagcaaaccaagaacctagtaccaaa
aacaatggcaaccaaaatgaacttacatttcaaaataatgggcaattgaccagagaagga
ttgcatctacttatgtctttgttgcattgtttacaaccattttcttcaaacacattatgt
gcggatcaagtttcagacctaacagatattgattggactcatccgctttataccgaccgt
acatttgctgctagtattggacgtttgttagataaccaaagatccttatttgaacagcgt
tccgaagaaagcgattcggatcggctaaaattattagcatttataagattgtcttgggca
ttgtgccttcgaagaacaagtcatttacgtgctgaactgcgccgccgtcagacagttgac
gttagccgatcaacaccttatactgtagctaataggaaagatcttgcaacactcaatgaa
gatttcgggattggcggagatgaagaagatgaattacaagctgctttagctattgaatct
ggagcgcttgagttcgctcgcaaacaaattttgaacactacagactttgaacgtgagcca
ctatgggtgtatcgtatgcattgtattattactgacttgattgtacatatggcagtacga
gtgaaggagattcgattacgggatgaagatatacttaggtctacaggttttgatccgtcg
actaccgggcacggttttgcaaactttttactgttaattgctcaactttataatcaacct
ggttctcgtctgcatggtcgattgggattggaattttggtggcctgttggtgagctaact
aacattgcaccagtagctttgggttcaagtgatcttttatctccaagtacagctgataaa
tctcctagaccaaagttccatacttacggtagtcagtcacgtaatgcagaacttgataac
attcgacaggcagcccttattcgctttttaagattagctggagatatggtgacagcgcct
tgtttatttctgccttatctacgtatgctacacggtttatgctgttctcgtagtgcagct
ggtctttgtttcagtcttctcaaagcaaatgctactaatcctgggcgtggtgcctcgtta
attacatgggatcattttttcaacagttttcgtcaatatttaaaccatatgaaacaggtt
gttgtgcaaccagaaccaactaactttcgacttcaagcttcaaatcaattgtatcctcat
ctttatttcaatgatggagttactcctcgttctcgtgtatcaggttttccacggtcaact
actgaatctatgtatggtcatagaaaaggttccagttcatccgatattggtgcaacaaca
gtacctatgaatattcaaccacgttccattcaaccagaagaacaagctggtctacaggct
gttttaagattggttgctcgtgtttgccgaatggatccggttgcacgttcaacgttcatt
tcaaatcctcaatggcagttaataccaatttgtatgggttttctaacttgtccagtttcg
ttagatttaaaagctgatatcttgtatttgcttactgaattttgtaaaagtcaacaaaat
attccagttatatggcaacattttgtcagttcagaaactgatatggatgaagtggaacca
cgagctgaagaatatccattgacaaatgcttttcttacgttaataactgttatgctccca
aaattgataaattatcctataccaatcccaagcaatgtattgagatctggtgatactaaa
gaaatgggcacttttggactaactagtattggtcataatataccatctcaaacaaatcca
tttctttcaattacatcatttataactaatacaatatttttaaggcatactatgagagcg
tatcgtaatccagtggaaagagttacgggtcttttagaagtaggcctacatagacatttg
gaatttcctatacctaatggtccaccagtttcaatgactcgtgcaacatatgctggtctt
agtttaatacgtcgactattggctagtgaagatattttagtaacatttgttcgacgtata
gcaacgaatattcaaccgcggattggatctgtacattcatcgtcgaatatatctattcca
ttaccaaatgttccttcatttggtcttactatacttcctgtatatgtttcacgtttatta
atgtcgactaatataggatctggaagagcagatcttattccaatgttattaaaatattgt
ttactagcagactatctaccggatcatacatcatgtgctgttagtattcttggttattta
gcttcatcaatacaaccacactcagatttgttagcattacttacagctgatgaaactaca
cgtaatcaattacttggtgcttttacatatttaatcaaatggccaatgaatgtagatatt
aattcaaatttaattccaatggataataatttagataatgaaggtcattttgcatttact
gatgaatggctctacggtgataatgataataatgaattatgtttacatagtgttggcaca
ttttcatctagattaccatcaccagtaatcaatgctgctcgttacgatgctgcatttcca
ttacaaacaaataattggtattttcctagtcgaatatgggaacgttgtgcttcatatctg
aatacatatttttctgaatggactgatatgagaattactcataatcgaatgaataataat
gattattatattcaggcatttggtgattggttctatcctgtaatggaacatcccgctcct
aacttagctcattggttgtgtggtttttgtgttgacaattgcaaagctattagtcgatca
aatttacaggatgccggtatagctgaccaacaacgaacatgtttacatagtatgcttgat
atgatagatagtactacacattggctacagtctataacaacattaccttttgaattctca
tgtacattacaatggaatttggcattaatttggcaaattttatataaattaggatcgaat
ccattaacatcggaacctttgttacgttttcttcgtggtaatcatgatttattagctaaa
tatttacattctgatctttgtcaacctttactgtcatcaagtcttgatggaaatgtatgt
gaaaatttcacggatcgacaaaaagcagttattgaagctttatcattaaatcgtaaaaac
tggatccttcgtttatacgccattgaaatacgtgtatgtgctatggctaatcaacgttct
tatgtaacgagattattgaaattattccttggtgctccttctgttcttgtgaactttttg
caaattctaaacacatccaatgaacttgtcaatgattgtaatccattcgaatcgaaattg
ttcaattcaaatgttctgcacgaattattgaaaaaatcatctatcaattgtcctttatta
agctcagattccaatgcaacaaaagtattatcaactatgatacatttcaaaatattcctt
atgaatttattcatgaagttaatcagtacacgtaatgatctagatagttattctaatgaa
gatctgaacaaactgattacattaacatttgatcaagtattcgatattaatcgatcagct
tatcatctatcaatcttagaagtattcaacacatcttatttatcatcatcctcatctaca
acaacagtatctgcattaataaaacaaatctctgacctacgtgaatggatagatcatcga
aatatacataatcttcatttgtatgctggtaaacaagtagctattgaagcatggagacaa
gcagttgagattagtttaggtttaatgacaaatcaaggacaatatgatagtggcaataat
aataatacagtacaaagatcttcaaatcaaccaatgatatctgtaccaagttatctatat
tcggaattaatcagtttattacgtaatgatggtgatggtgatatcggtattggatcaaat
aatatgtcacaatataaatttaaacttcgtccagttccagttctttgtttagatgtgctt
attctgttattatctcagatttgttctgtgaaagaagttccacaaactattcgtctatta
gccagtggtactagtttgacgctatgttcattttttcattgtcaatcatcatatgttaac
gcatccaagtcaaatatttcagaaatgccaacaagtggattggataaatgtgtctataat
aaacattggtctcctttacttatatcagtgatggaattattagttaagtcaatcgttaga
actaaaacttcaacacaacgtatgcgtgccaattattatggaagtttatgctatgtgata
cgtttctgtcgagatcttggtcaatcattaaaagacgataaagtatcgttaactgatttc
aattctttaatggaatgcttctctatattcaattattcaactactaatactaataccaat
ttgaatacaattcattcaaatgcattaaactcttctgatttaaatcaattacattctaca
ttaattactgatataattcatggacatacaatgattcaattagctgcaatgagtttatta
gaattgttaatctcatttgatcgttgctcccaacaactaattacatatcttgacaatcaa
ggaactattcagcatattttagatacgatcattgaagatttacaagttataggtaaattt
cttacttcagtcaatacggaattacccgattattcatctgtattaaatcgttctaattat
ttaccacttgaatcaaataataataataatcataattatcctaatgaagattcatcatcg
attatgtcatcatatttattatatcagtcaaagatgtcaattctatgcagaataggcagt
tatcctattggtgcaaagattttagctaatcatggaatcataaatcgtctaaccaattgt
gatgtactctcattatcaaatttagctaattgttattcttacggtctagattgtttatat
atttgtgaagacgataataataataataatcaacaataccaagacatcagtcatcgatca
aatgaatcaaatcaattaatggatttaatttggttccgttcatctaaatttcaacgttac
ctctcctattcgtcatcatcatcatcgtcttctattgttggaaaaagtgatcattctatt
tattgggattttattgaatccattattagtagtataatgatagaacctggttgtgaaata
gacgagaatgaattaatgaaaattaattgggcaggattgttgattccaacattaagactt
tcaaaaattttgataaattcattaggtacaacacatatgtctattaatcaacaaattgtc
aatttcctacatacacattctagttcattaatgtgtaatgaaatacaattagccagttca
attgtaacatttttaagccgacaagattggtcttacattaatcattcaaattcttcttct
tcttcttctactaatcaaccaattaattcaaattggcttatacaatggattgcatcagaa
acaaatcttataaatttgtttagtttaattatgccaagttttaatagtccagttagtata
atgtgttcagatgaatattccaatcttcaacgtgaagttattcaatctaaaattctaaat
catacatttgaattacttatcaatttaattcatccatctaatattcattcatttactgat
aatgatttaagtagtatatataaatttcaaaataattattttgcttttgaatattcattt
attgaaacacaatatattcaattaatctatagtttattatttatattaactggttatata
agtataccagaatatagaatacgtaaatttataacagataatataaataatcatactaca
gcacgtacattatttcaatattttaatcattcaataattcattcagaacaagaaaattca
acattcaatgtaaaaattcaaaatacattaacattaattgtcaatttattacaatggtca
ttgaaatgtctacgaagcaaagagaaaatttgtttagctttaatcaatgttcaatttctc
aatagtagtagtaatagtcgcacaaaagaaccaacaaaaagtaaaataattggtgaacaa
aggaatcaacaacaacaacaatttggacaatcgattgttcaattactgaattgtgaatca
ttcagtgaaaatctgccaatcaatgaattaaaacaagcatcatccatcatattcaaatgc
cccttacaattattaaattctgttgaccgaattactgctggtaaggaaaatcaaaatgct
gaaattcaaatgatgcaacggttaactcaacttggtgtcagttgtctacgtgttcaacta
cgtggacttattgtcaacatttttattatggaaacatttaaacagtcttataaacaatcc
tatattataattggtgaaaacaataaagaaactccattacatcatcaatctttacaatct
tcacatggtgttcgtaatctttctaccactaattgtattacttctccaatgatgaaatct
tctttaaaaccattgttaactccaactaaacgtaatacattaatgaatacagcatttagc
caagaaaataatagtatacttcaaatgaatatgtcttggttacgtaatcattgtgaacat
ttagtacaagatgaaataatggaaatgcttaaccagttaactaaggcggcttatttaaaa
caaaatcaacgattatttatacaagtaatgcataatcgtttagaaagaataatacaaaaa
caattgaacagtaacctgtcaacatga

DBGET integrated database retrieval system