KEGG   Schistosoma mansoni: Smp_163810Help
Entry
Smp_163810        CDS       T01095                                 

Definition
laminin gamma-1 chain
Orthology
K05635  
laminin, gamma 1
Organism
smm  Schistosoma mansoni
Pathway
ECM-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:smm04512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 1259 aa AA seqDB search
MGLLLLRWCIILISVIVANSQEPFDTRWVSSECVDINGKPQMCYPPFTSVAADRKVTATN
TCGERGRQKYCIHMSNSGMASRCQYCDARNPDESHPPEYMTDKNPNNWWQSETMADNKLL
HFRDSVNLTIDLGTQFHVNYVYLQFKSPRPHAMVIHKRFDDNSEWTPWAYFSSNCYTYFG
MVYSPRPVFNKPDELICYEEYSTLQPLYEGEVIFSVINGRPNYDRFFNDVDLQRWSTASQ
ILIELKKMHTFGDERGAERDTLLTYYFAIQKLTVGGRCLCNGHGNECRKSSGPGQKERLV
CVCDPAHHTSGDNCEQCQSGYHDRPWQPATPQNANPCIACNCNGNAHLCEFDPELYSRTG
SGSRCIDCGNNTEGLNCERCKSGYYPNPKQPTTCLPCSCDPVGTIDGQTECNAQGQCQCK
PGIGGKSCDHCLEDHFGFNAGGCLPCNCNEGGSYENRPACDSQTGQCICKQNVAGKQCDK
CKIGHYGLMSNDPLGCKPCLCSLHSSECKLDEEHLSNVAGRPGGDDLALISHTQQQVQEK
TTSVAAASAAVGLNINKGKSKTLRYNSTCTNRNTLDGEASDNVKTFTYLGSIIDEHGGSD
VDMRARIGKARAAYLQLKNIWNSKQLSTNTKIRIFNTNVKTVSLYLVETCGTTKAIIQKM
QVLINSCLRWRTPQTDPRSEICTCPPQYTGKSCEFCADGHRRDPPGGLITDRCILCTCNN
HATRCDPESGQCECQDNTGGLFCDRCADGYYGDAFASVNSSDACKPCPCPSEAKCEQVYW
PDRSIKVVCKDCPDNRSGIRCERCAENFYGDPAKGIPCKPCDCSNNVDPREFGNCDGKTG
ECLKCLFGTSGKHCEQCLSGYRRNFKPINISDLSDLIPARGCSPCECNPIGTLANYGSQG
IGVCNPETGQCPCNPGVGGVNCDKCFDGFYGFHTGQGCQPCDCNSVGAVQESCDDRTGQC
ECRPNVIGRQCDQCRPAYFNMTTSVGCQSCNCHIYGAESSQCNKNGQCICKPFAVGVNCE
QCQENHYNLQAGCLPCPACYNLVQARVAKLWGMLESVFGPIKQGPSTTSLIPRGSTETLN
DKELYEEIKRLNDTVVKLYQDILDYKADSSIIDYKQFKKTLDNIANQIDMIDNELKQLIN
KPLTCIENDYNKNMEQLQMSINEKIPRLLTDDAQRVLENLKRTISSSESDPILTKYANEL
NELSKELNERSEQLQKKVNSITQLLANSINKLTESKELIKTSKDTLQKNIKKELLKSKG
NT seq 3780 nt NT seq  +upstreamnt  +downstreamnt
atgggcttgttactacttagatggtgcatcatcctcatttcagtgatagtcgcaaactca
caagagccatttgacacaagatgggtttcaagtgaatgcgtagatataaacgggaaacca
cagatgtgttatcctccatttactagcgttgctgctgacagaaaagttacagcaaccaac
acatgcggagaaagaggaaggcaaaagtattgcatacacatgtcaaattctggaatggct
agcaggtgtcaatactgcgacgctcgcaatccagatgagagtcatccaccggagtatatg
acagataaaaatcctaataactggtggcaatcagaaactatggcagataataaacttctg
catttcagggactctgtgaatcttacgatagatcttggtactcaatttcatgtcaattat
gtgtatttacaatttaaatcacctcgtccacatgctatggttatacataaacgatttgat
gataattctgaatggacaccatgggcatatttttcgagtaattgttatacatattttggt
atggtctatagtccaagacctgtatttaataaaccggatgaattgatatgttatgaagaa
tattcaacattacaaccattatatgaaggggaagtcattttctctgttataaatggacgt
ccaaactatgatagatttttcaatgatgtagatttacagcgttggagtactgccagtcaa
attttaatagaactaaagaaaatgcatacatttggtgatgaacgtggagctgaaagagac
actctattaacatattattttgctatacaaaaattgactgtaggaggaagatgtctttgt
aatggtcatggtaatgaatgtagaaaaagttctggaccaggacaaaaagaaagattagta
tgtgtttgtgatccagctcatcatacatccggtgataattgtgaacaatgtcaatcaggt
tatcatgatcgtccatggcaacctgctactccacaaaatgctaatccatgtatagcatgt
aattgtaatggaaacgcacatctatgtgaatttgatccggaattatatagtcgtactggt
tccggtagtcgatgtattgattgtggcaataatactgaaggcttaaattgtgaacgatgt
aaatcaggttattatcctaatccgaaacagccaacaacatgcttaccatgttcatgtgat
ccagtgggtactattgatggacagactgaatgtaatgcacaaggtcaatgtcaatgtaaa
cctggaattggtggtaaatcttgtgatcactgtttagaagatcattttggtttcaatgct
ggtggttgtctaccatgtaattgtaatgaaggtggtagttatgaaaatcgtcctgcttgt
gattctcaaacaggtcaatgtatatgtaaacaaaatgtagctggtaaacaatgtgataaa
tgtaagattggtcattatggtctcatgtcaaatgatccattaggatgtaaaccgtgctta
tgttctttgcattcatcagaatgtaaactagacgaagaacacttaagtaatgtagctggt
agacctggcggagacgacctggctcttatatcacacacgcaacaacaagtgcaggagaaa
acgaccagtgtagcagcagcctcagcagcagtaggtctcaatataaacaaagggaaaagc
aagactctccgatacaattcaacatgcactaatcgaaatacacttgatggtgaagcttcg
gataatgtgaaaacctttacatatctgggcagcatcattgatgaacatggtggatcagat
gtagatatgagggcgaggatcggtaaagcaagagcagcatatttacaactgaagaacatc
tggaactcaaaacaattgtcaaccaacaccaagatcagaatttttaatacaaatgtcaag
acagtttcactgtatctggtggaaacttgtggaactacgaaagccatcatccagaagatg
caagtgcttatcaacagttgtctacgctggcgtacgccacagactgatcctcgttctgaa
atatgtacatgtcctccacaatacactggtaaatcatgtgaattttgtgcagatggacat
agacgtgatccacctggtggtcttattactgatcgttgtatcttatgtacatgtaataat
catgctacacggtgtgatcctgaaagtggtcaatgtgaatgtcaagataatactggtggt
ttattttgtgatcgatgtgctgatggttattatggtgatgcatttgcttcagtcaattca
tctgatgcttgtaaaccatgtccatgcccttcagaagcaaaatgtgaacaagtttattgg
ccagatcgttcaattaaagttgtatgtaaagattgtccagataatagatcaggtattcga
tgtgaacgttgtgcggagaatttttatggtgatccggcgaaaggtattccatgtaaacca
tgtgactgttcaaataatgtggatccaagagaatttggaaattgtgatggaaaaactggt
gaatgtttaaaatgtttatttggtacaagtggtaaacattgtgaacaatgtttatcaggt
tatcgtcgtaattttaaaccaattaatataagtgatttaagtgatttaattccagcacgt
ggttgtagtccatgtgaatgtaatccaattggaacattagctaattatggttcacaagga
attggtgtttgtaatccagaaactggtcaatgtccatgtaatcctggtgttggtggagta
aattgtgataaatgttttgatggattttatggttttcatactggacagggatgtcaacca
tgtgactgtaattcagtgggtgcagttcaagaatcctgtgatgatcgtaccggtcaatgt
gaatgtcgtccaaatgttatcggacgtcaatgtgatcaatgtcgacctgcatattttaat
atgactacttcagtaggttgtcaatcatgtaattgtcatatttatggtgctgaaagtagt
caatgtaataaaaatggtcaatgcatttgtaagccttttgctgttggagttaactgtgaa
caatgtcaggaaaatcattacaatttacaagccggttgtttaccatgtccagcttgctat
aatttagttcaagccagagttgctaaattatggggaatgttagagtcagtatttggacca
attaaacaaggaccatcaacaacatcactaataccaaggggatcaactgaaacacttaat
gacaaggaattatatgaagagatcaaacgattaaatgatacggttgtaaaattatatcag
gacattttagattataaagctgatagttcaattattgattataaacaatttaaaaaaaca
ttagataatattgctaatcaaatcgatatgattgataatgaattaaaacaattgatcaat
aaaccattaacatgtatagaaaatgattataataaaaatatggaacaattacaaatgtct
attaatgaaaaaataccaagattattaacggatgatgctcaaagagtattggaaaattta
aaacgtactattagttcatctgaatcagatccaatcttaacaaaatatgcaaatgaacta
aatgaattatctaaagaattaaatgaaagaagtgaacaattacaaaagaaagtgaatagt
attacacaattattagctaattccattaataaattaactgaatcaaaagaattaattaaa
acatcaaaagatacattacagaaaaatataaaaaaggagcttttaaagtcaaaaggttga

DBGET integrated database retrieval system