KEGG   Schistosoma mansoni: Smp_163810Help
Entry
Smp_163810        CDS       T01095                                 

Definition
laminin gamma-1 chain
Orthology
K05635  
laminin, gamma 1
Organism
smm  Schistosoma mansoni
Pathway
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:smm00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    Smp_163810
Cell adhesion molecules and their ligands [BR:smm04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      Smp_163810
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      Smp_163810
     Laminin-2 Extracellular matrix (ECM) components
      Smp_163810
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      Smp_163810
   VLA-3
      Smp_163810
     Laminin-10 Extracellular matrix (ECM) components
      Smp_163810
     Laminin-11 Extracellular matrix (ECM) components
      Smp_163810
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      Smp_163810
     Laminin-8 Extracellular matrix (ECM) components
      Smp_163810
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      Smp_163810
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      Smp_163810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 1259 aa AA seqDB search
MGLLLLRWCIILISVIVANSQEPFDTRWVSSECVDINGKPQMCYPPFTSVAADRKVTATN
TCGERGRQKYCIHMSNSGMASRCQYCDARNPDESHPPEYMTDKNPNNWWQSETMADNKLL
HFRDSVNLTIDLGTQFHVNYVYLQFKSPRPHAMVIHKRFDDNSEWTPWAYFSSNCYTYFG
MVYSPRPVFNKPDELICYEEYSTLQPLYEGEVIFSVINGRPNYDRFFNDVDLQRWSTASQ
ILIELKKMHTFGDERGAERDTLLTYYFAIQKLTVGGRCLCNGHGNECRKSSGPGQKERLV
CVCDPAHHTSGDNCEQCQSGYHDRPWQPATPQNANPCIACNCNGNAHLCEFDPELYSRTG
SGSRCIDCGNNTEGLNCERCKSGYYPNPKQPTTCLPCSCDPVGTIDGQTECNAQGQCQCK
PGIGGKSCDHCLEDHFGFNAGGCLPCNCNEGGSYENRPACDSQTGQCICKQNVAGKQCDK
CKIGHYGLMSNDPLGCKPCLCSLHSSECKLDEEHLSNVAGRPGGDDLALISHTQQQVQEK
TTSVAAASAAVGLNINKGKSKTLRYNSTCTNRNTLDGEASDNVKTFTYLGSIIDEHGGSD
VDMRARIGKARAAYLQLKNIWNSKQLSTNTKIRIFNTNVKTVSLYLVETCGTTKAIIQKM
QVLINSCLRWRTPQTDPRSEICTCPPQYTGKSCEFCADGHRRDPPGGLITDRCILCTCNN
HATRCDPESGQCECQDNTGGLFCDRCADGYYGDAFASVNSSDACKPCPCPSEAKCEQVYW
PDRSIKVVCKDCPDNRSGIRCERCAENFYGDPAKGIPCKPCDCSNNVDPREFGNCDGKTG
ECLKCLFGTSGKHCEQCLSGYRRNFKPINISDLSDLIPARGCSPCECNPIGTLANYGSQG
IGVCNPETGQCPCNPGVGGVNCDKCFDGFYGFHTGQGCQPCDCNSVGAVQESCDDRTGQC
ECRPNVIGRQCDQCRPAYFNMTTSVGCQSCNCHIYGAESSQCNKNGQCICKPFAVGVNCE
QCQENHYNLQAGCLPCPACYNLVQARVAKLWGMLESVFGPIKQGPSTTSLIPRGSTETLN
DKELYEEIKRLNDTVVKLYQDILDYKADSSIIDYKQFKKTLDNIANQIDMIDNELKQLIN
KPLTCIENDYNKNMEQLQMSINEKIPRLLTDDAQRVLENLKRTISSSESDPILTKYANEL
NELSKELNERSEQLQKKVNSITQLLANSINKLTESKELIKTSKDTLQKNIKKELLKSKG
NT seq 3780 nt NT seq  +upstreamnt  +downstreamnt
atgggcttgttactacttagatggtgcatcatcctcatttcagtgatagtcgcaaactca
caagagccatttgacacaagatgggtttcaagtgaatgcgtagatataaacgggaaacca
cagatgtgttatcctccatttactagcgttgctgctgacagaaaagttacagcaaccaac
acatgcggagaaagaggaaggcaaaagtattgcatacacatgtcaaattctggaatggct
agcaggtgtcaatactgcgacgctcgcaatccagatgagagtcatccaccggagtatatg
acagataaaaatcctaataactggtggcaatcagaaactatggcagataataaacttctg
catttcagggactctgtgaatcttacgatagatcttggtactcaatttcatgtcaattat
gtgtatttacaatttaaatcacctcgtccacatgctatggttatacataaacgatttgat
gataattctgaatggacaccatgggcatatttttcgagtaattgttatacatattttggt
atggtctatagtccaagacctgtatttaataaaccggatgaattgatatgttatgaagaa
tattcaacattacaaccattatatgaaggggaagtcattttctctgttataaatggacgt
ccaaactatgatagatttttcaatgatgtagatttacagcgttggagtactgccagtcaa
attttaatagaactaaagaaaatgcatacatttggtgatgaacgtggagctgaaagagac
actctattaacatattattttgctatacaaaaattgactgtaggaggaagatgtctttgt
aatggtcatggtaatgaatgtagaaaaagttctggaccaggacaaaaagaaagattagta
tgtgtttgtgatccagctcatcatacatccggtgataattgtgaacaatgtcaatcaggt
tatcatgatcgtccatggcaacctgctactccacaaaatgctaatccatgtatagcatgt
aattgtaatggaaacgcacatctatgtgaatttgatccggaattatatagtcgtactggt
tccggtagtcgatgtattgattgtggcaataatactgaaggcttaaattgtgaacgatgt
aaatcaggttattatcctaatccgaaacagccaacaacatgcttaccatgttcatgtgat
ccagtgggtactattgatggacagactgaatgtaatgcacaaggtcaatgtcaatgtaaa
cctggaattggtggtaaatcttgtgatcactgtttagaagatcattttggtttcaatgct
ggtggttgtctaccatgtaattgtaatgaaggtggtagttatgaaaatcgtcctgcttgt
gattctcaaacaggtcaatgtatatgtaaacaaaatgtagctggtaaacaatgtgataaa
tgtaagattggtcattatggtctcatgtcaaatgatccattaggatgtaaaccgtgctta
tgttctttgcattcatcagaatgtaaactagacgaagaacacttaagtaatgtagctggt
agacctggcggagacgacctggctcttatatcacacacgcaacaacaagtgcaggagaaa
acgaccagtgtagcagcagcctcagcagcagtaggtctcaatataaacaaagggaaaagc
aagactctccgatacaattcaacatgcactaatcgaaatacacttgatggtgaagcttcg
gataatgtgaaaacctttacatatctgggcagcatcattgatgaacatggtggatcagat
gtagatatgagggcgaggatcggtaaagcaagagcagcatatttacaactgaagaacatc
tggaactcaaaacaattgtcaaccaacaccaagatcagaatttttaatacaaatgtcaag
acagtttcactgtatctggtggaaacttgtggaactacgaaagccatcatccagaagatg
caagtgcttatcaacagttgtctacgctggcgtacgccacagactgatcctcgttctgaa
atatgtacatgtcctccacaatacactggtaaatcatgtgaattttgtgcagatggacat
agacgtgatccacctggtggtcttattactgatcgttgtatcttatgtacatgtaataat
catgctacacggtgtgatcctgaaagtggtcaatgtgaatgtcaagataatactggtggt
ttattttgtgatcgatgtgctgatggttattatggtgatgcatttgcttcagtcaattca
tctgatgcttgtaaaccatgtccatgcccttcagaagcaaaatgtgaacaagtttattgg
ccagatcgttcaattaaagttgtatgtaaagattgtccagataatagatcaggtattcga
tgtgaacgttgtgcggagaatttttatggtgatccggcgaaaggtattccatgtaaacca
tgtgactgttcaaataatgtggatccaagagaatttggaaattgtgatggaaaaactggt
gaatgtttaaaatgtttatttggtacaagtggtaaacattgtgaacaatgtttatcaggt
tatcgtcgtaattttaaaccaattaatataagtgatttaagtgatttaattccagcacgt
ggttgtagtccatgtgaatgtaatccaattggaacattagctaattatggttcacaagga
attggtgtttgtaatccagaaactggtcaatgtccatgtaatcctggtgttggtggagta
aattgtgataaatgttttgatggattttatggttttcatactggacagggatgtcaacca
tgtgactgtaattcagtgggtgcagttcaagaatcctgtgatgatcgtaccggtcaatgt
gaatgtcgtccaaatgttatcggacgtcaatgtgatcaatgtcgacctgcatattttaat
atgactacttcagtaggttgtcaatcatgtaattgtcatatttatggtgctgaaagtagt
caatgtaataaaaatggtcaatgcatttgtaagccttttgctgttggagttaactgtgaa
caatgtcaggaaaatcattacaatttacaagccggttgtttaccatgtccagcttgctat
aatttagttcaagccagagttgctaaattatggggaatgttagagtcagtatttggacca
attaaacaaggaccatcaacaacatcactaataccaaggggatcaactgaaacacttaat
gacaaggaattatatgaagagatcaaacgattaaatgatacggttgtaaaattatatcag
gacattttagattataaagctgatagttcaattattgattataaacaatttaaaaaaaca
ttagataatattgctaatcaaatcgatatgattgataatgaattaaaacaattgatcaat
aaaccattaacatgtatagaaaatgattataataaaaatatggaacaattacaaatgtct
attaatgaaaaaataccaagattattaacggatgatgctcaaagagtattggaaaattta
aaacgtactattagttcatctgaatcagatccaatcttaacaaaatatgcaaatgaacta
aatgaattatctaaagaattaaatgaaagaagtgaacaattacaaaagaaagtgaatagt
attacacaattattagctaattccattaataaattaactgaatcaaaagaattaattaaa
acatcaaaagatacattacagaaaaatataaaaaaggagcttttaaagtcaaaaggttga

DBGET integrated database retrieval system