KEGG   Schistosoma mansoni: Smp_163900Help
Entry
Smp_163900        CDS       T01095                                 

Definition
dopamine-beta-monooxygenase (EC:1.14.17.1)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
smm  Schistosoma mansoni
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:smm00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 499 aa AA seqDB search
MINNLFVLILEEWQLLVVKMVIVLIGNQHVVEKGNEYSGSYVICLEEEEEGTETGNVWWS
GNHVGLHDYVVYSNAKISIYEKNAFHSIYDHISRHDVIYQMWLHRIGLTPMISLNNLEMK
QIPYKKILLQLIKSSSYTDFKVTEDIKIFSLHVHKSSLNDSSNKVDMLLKTLIDFIYNLE
NEIVYLPKYDGGVSMHSEVEVPAVETTYWCKTIELPYFSEPHHIVRYENDIQERSQGFIH
HMEVFRCPGHNKRYYDAPCNSETKPEDLIDCREVIAAWAMGSTGLTFPEEAGYPIGGLSG
KEYAVIEIHYYNPDNISGIIDNSGFRFYITNQLRKYDVGIMELGLVYTPNNFIPFKQSNF
FLSGYCDSQCTDITLPKPNGIFVFASQLHTHLTGIKVVTYHIRNGTRLPDLNRDNYYSPH
FQEIRQLDQQIQIKPGDTLITRCTYDTSQKNQITFGGIRINDEMCLNYIFYYPKIDLELC
KSDISIESLNIFLNTLDDK
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacaatttatttgttttaattttggaagaatggcaacttcttgtcgtgaaaatg
gttatagtattaataggaaatcaacatgttgtagagaaagggaatgaatattcaggaagt
tatgtaatatgtttggaagaagaagaagaaggaacagagactggaaatgtgtggtggagt
ggaaatcatgttggattgcacgattacgttgtctattcgaatgccaaaatatctatttat
gagaagaatgcttttcacagtatatatgatcatatcagtagacatgatgtcatctatcaa
atgtggttacatcgtattggattaactccaatgatttcattgaataatttagaaatgaaa
caaattccatataagaagattttattacaattaatcaagagttcatcatatactgatttt
aaagtgactgaagatattaaaatcttttcattacatgttcataaatcttctttgaatgat
tcatcaaataaagttgatatgttactgaaaacattgattgattttatttataatcttgaa
aatgaaatcgtttaccttccgaaatatgacggtggagtttcaatgcattcagaagttgaa
gtacctgcagttgaaacaacgtactggtgcaaaactattgaactaccttatttctcagaa
ccacatcatatagtcaggtatgaaaatgatatacaagaaagaagtcaaggatttattcat
catatggaagtttttcgttgtcctggacataataaacgttactatgatgcaccatgtaat
tcagaaacaaaaccagaagatttaattgactgtagagaagtaatagcagcatgggctatg
ggttcaacaggattaacttttccagaagaagctggatatcctattggaggattaagtggt
aaagaatatgcagtgattgaaatacattattataatccagataatatatcaggtatcata
gataatagtggatttcgtttctatattactaatcaattaagaaaatatgatgttggtata
atggaacttggtttagtctatacaccgaataattttattccatttaaacagtcaaatttt
tttctttctggatattgtgattctcagtgtactgatataactttaccaaaaccgaatggt
atatttgtatttgcatcacaattacatacacatttaacaggaatcaaagttgttacatat
catataagaaatggtacacgattaccagatcttaatagagataattattattcaccacat
tttcaagaaatacgtcaacttgatcaacaaatacaaataaaaccaggtgatactttaatt
acaaggtgtacttatgatacaagtcaaaagaatcaaataacttttggtggaataagaatc
aatgatgaaatgtgtttaaattatatattttattatcctaaaattgatttggaattatgt
aaatcggatatatctattgaatcattaaatatattcttgaatacattggatgataagtaa

DBGET integrated database retrieval system