KEGG   Schistosoma mansoni: Smp_163900Help
Entry
Smp_163900        CDS       T01095                                 

Definition
dopamine-beta-monooxygenase (EC:1.14.17.1)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
smm  Schistosoma mansoni
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Smp_163900
Enzymes [BR:smm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     Smp_163900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 499 aa AA seqDB search
MINNLFVLILEEWQLLVVKMVIVLIGNQHVVEKGNEYSGSYVICLEEEEEGTETGNVWWS
GNHVGLHDYVVYSNAKISIYEKNAFHSIYDHISRHDVIYQMWLHRIGLTPMISLNNLEMK
QIPYKKILLQLIKSSSYTDFKVTEDIKIFSLHVHKSSLNDSSNKVDMLLKTLIDFIYNLE
NEIVYLPKYDGGVSMHSEVEVPAVETTYWCKTIELPYFSEPHHIVRYENDIQERSQGFIH
HMEVFRCPGHNKRYYDAPCNSETKPEDLIDCREVIAAWAMGSTGLTFPEEAGYPIGGLSG
KEYAVIEIHYYNPDNISGIIDNSGFRFYITNQLRKYDVGIMELGLVYTPNNFIPFKQSNF
FLSGYCDSQCTDITLPKPNGIFVFASQLHTHLTGIKVVTYHIRNGTRLPDLNRDNYYSPH
FQEIRQLDQQIQIKPGDTLITRCTYDTSQKNQITFGGIRINDEMCLNYIFYYPKIDLELC
KSDISIESLNIFLNTLDDK
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacaatttatttgttttaattttggaagaatggcaacttcttgtcgtgaaaatg
gttatagtattaataggaaatcaacatgttgtagagaaagggaatgaatattcaggaagt
tatgtaatatgtttggaagaagaagaagaaggaacagagactggaaatgtgtggtggagt
ggaaatcatgttggattgcacgattacgttgtctattcgaatgccaaaatatctatttat
gagaagaatgcttttcacagtatatatgatcatatcagtagacatgatgtcatctatcaa
atgtggttacatcgtattggattaactccaatgatttcattgaataatttagaaatgaaa
caaattccatataagaagattttattacaattaatcaagagttcatcatatactgatttt
aaagtgactgaagatattaaaatcttttcattacatgttcataaatcttctttgaatgat
tcatcaaataaagttgatatgttactgaaaacattgattgattttatttataatcttgaa
aatgaaatcgtttaccttccgaaatatgacggtggagtttcaatgcattcagaagttgaa
gtacctgcagttgaaacaacgtactggtgcaaaactattgaactaccttatttctcagaa
ccacatcatatagtcaggtatgaaaatgatatacaagaaagaagtcaaggatttattcat
catatggaagtttttcgttgtcctggacataataaacgttactatgatgcaccatgtaat
tcagaaacaaaaccagaagatttaattgactgtagagaagtaatagcagcatgggctatg
ggttcaacaggattaacttttccagaagaagctggatatcctattggaggattaagtggt
aaagaatatgcagtgattgaaatacattattataatccagataatatatcaggtatcata
gataatagtggatttcgtttctatattactaatcaattaagaaaatatgatgttggtata
atggaacttggtttagtctatacaccgaataattttattccatttaaacagtcaaatttt
tttctttctggatattgtgattctcagtgtactgatataactttaccaaaaccgaatggt
atatttgtatttgcatcacaattacatacacatttaacaggaatcaaagttgttacatat
catataagaaatggtacacgattaccagatcttaatagagataattattattcaccacat
tttcaagaaatacgtcaacttgatcaacaaatacaaataaaaccaggtgatactttaatt
acaaggtgtacttatgatacaagtcaaaagaatcaaataacttttggtggaataagaatc
aatgatgaaatgtgtttaaattatatattttattatcctaaaattgatttggaattatgt
aaatcggatatatctattgaatcattaaatatattcttgaatacattggatgataagtaa

DBGET integrated database retrieval system