KEGG   Schistosoma mansoni: Smp_164960Help
Entry
Smp_164960        CDS       T01095                                 

Definition
phosphatidylinositol-45-bisphosphate 3-kinase catalytic subunit alpha PI3K
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
smm  Schistosoma mansoni
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Smp_164960
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    Smp_164960
   04068 FoxO signaling pathway
    Smp_164960
   04070 Phosphatidylinositol signaling system
    Smp_164960
   04150 mTOR signaling pathway
    Smp_164960
Enzymes [BR:smm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     Smp_164960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 1340 aa AA seqDB search
MSPTAKLKRTFSLLVGSDIIIKFLLPNGIIIPLTVNSESTLEEIKLQLWISAAKLPLFDI
LQSKNDYIFAGVNRDTADEEEFYDINRRLHEIPLLLPYLRVVETARDTTLLKISNQNAAI
SSCTGIPHTDIIRACRTNPEVKWARLRLLRVANMHTKALNQTGSDGLIRYLTSASKRELS
QSLKVLLQKQTHLTITAWVLDGKDPPEKCRVVIELDKKATVFNALNEILHAQAELARQDC
QVKMSYGLPEASNYLLKVCCSQAYLFDSDELLIHYEYIQQCIEHYQHPCLSPILKNDIKQ
SLHNCLNEYNKNPIYQLNHDNDSWIISPKSTLNTYASNFDKSNNNSIDLYQQLENFLINH
DKFDKCETDECIDNIDDNFIDCRSFVDSNKDDDTSAFNDIDSAHPVLLSENCSSKNVEGR
QKKSESPFTLTSDRQQNVSLWELSGFLSVQVCSAQFLVENIANLNSSSTTSLSLSTIASS
SIHQSNPNLNVVQHTSVNGGAALDGSYVVRVGIFHGSQFLIECQTTKERPGNYLTWREWL
NFHILLADLPIATRICVALIRIRRIVDRKNVRFCEYLYGWGNVSLFDHNDFMITGEITLN
LWPPSLVQTADESLHPCGTVLGNPNPEFSVQIKIHNPTQGRIRRPTVNCFINAYHTKKFH
SSSSQSYSDSHSLKSRNDGYAKSTKVDYSFCASEIEGDVDTCLGIESNNNLTIHNNAYVG
DIPLEFVSNKSFQNNTITSSVTNLTNKILESRLREIVSRDPLYELCEQEKDYLWRGRYWC
LNNLPSALPWICQVVNWCGRETLAEFYTLIHQWPQPFNVDIALRLLGAFDLTRSNSNLID
LPNGIKVGASGIADSYLRELAVNSLYNLSDAELSDYLLQLVQALKAETYLDNALTRFILY
RALKNPLQIGLRLFWHLRSELHLPDMRLRFSLILEAFCRGCGPMLVLLSRQVTALNRLEA
LSTRLKELTSEDEQRELFREEISRTETQHDLQWLPSPLCLSEILGELLIHKCDVKRSKKK
PLWLVWTNPDRLAQFHHQNYQLIFKHGDDLRQDMLTLQLLKLMDRIWKEEGMDMCLTSYG
CFATGYEMGIIEAVRDSRTVMSIQGERLRSALQIDSSQLYKWLMQHAKQKARQLNHSPLG
DNSAYERMIRTFTMSCAGYCVATFILGIRDRHPDNIMVDSTGRLFHIDFGHILDNRKKKF
GFTRERVPFVLTKDFITVIARGNPDAGAITTTNTPSSVTHNTIGGIYGNMYFQEFTDLCG
KAYLLLRKHSNLILTLLAMMLPSGLPELTSVCDLEHVRKTLAVEIDNEHEALAYFHHKFN
EAYSGAWTTKIDWFSHWMNT
NT seq 4023 nt NT seq  +upstreamnt  +downstreamnt
atgtctccaactgctaaacttaaaaggacattctccctactggtgggttcggatataatt
ataaaatttcttcttcctaatgggattataataccactcacagtgaattcagagtcaaca
ttagaagaaatcaaattacagctttggatttccgcagctaaattaccgttatttgatata
ttacaatcaaagaatgactacatatttgctggtgtcaaccgagatactgctgacgaagaa
gagttttatgatataaatcgtcgacttcatgaaattccacttcttttaccttacttacgt
gttgttgaaactgcaagagatactaccctattaaaaatcagtaatcagaatgctgcaatc
tccagttgtacaggtataccacatacagatatcatacgtgcttgtagaacaaaccctgaa
gtaaaatgggcacgattacgtttattacgcgtcgctaatatgcatacaaaagcactgaat
caaaccggatcagatggtttgatccgttacttaacttcagctagtaaacgtgaattaagc
cagtcattaaaagttcttctccaaaagcaaacacatcttacaataacagcatgggtatta
gatggtaaagacccaccggaaaaatgtcgtgttgtcatcgaattagataagaaagctact
gtatttaacgctttaaatgaaattttgcatgcacaagctgaactggctagacaagattgt
caagttaaaatgagttatggtctcccagaggcatcaaattatttactgaaagtttgttgt
tcacaagcttatctattcgattcggacgaattactcattcactatgaatatatacaacaa
tgtattgaacattatcaacatccttgtttaagtccaatattaaagaacgacattaaacaa
agtttgcataactgtcttaatgaatataataaaaatcctatttatcaactgaatcatgac
aacgatagttggataatctctccgaaatctactctaaatacctatgccagtaactttgat
aaaagcaacaataattcaattgatttatatcaacagttagaaaattttttaatcaatcat
gataaatttgacaaatgtgagactgatgaatgcatagacaacattgacgacaattttatc
gactgtcgatcatttgttgattccaataaagacgatgatacatcagcttttaacgacatt
gatagtgctcacccagtccttttatctgaaaactgttcttcaaaaaatgttgaaggtagg
caaaagaaatcagaatctccatttacactcacatctgaccgtcaacaaaatgtatctctt
tgggaattaagtggatttttgagtgtacaagtttgttcagcacagtttcttgtcgaaaat
attgcaaatttaaattcttcctcaacaacctccctctccttatcaacaattgcatcctct
tcaatacatcagtcaaatcctaacttaaatgttgtacaacatacaagcgtaaatggtgga
gctgctttagatggaagttatgttgtacgagtgggaatatttcatggtagtcagttttta
attgaatgtcaaacaactaaagaaagaccgggaaactacttaacatggcgtgaatggctt
aattttcacattctattagctgatctacctattgctacacgcatctgtgtagcgcttata
cgaatcagaagaattgtggatcgaaaaaatgtgagattttgtgaatatctatatggctgg
ggtaatgtcagtttatttgatcacaatgatttcatgatcacgggtgaaatcactttaaat
ttatggccaccctctttagttcagacggcggatgaaagtcttcatccttgtggtactgta
cttggtaaccccaatcctgaattctcagtacagatcaaaattcataacccaactcaaggt
cgcattcgtcgaccaacagtgaattgttttatcaatgcatatcatacaaaaaaatttcat
tcctcttcatcccaatcctattcagatagtcattcattaaaatcacgcaatgatggttat
gctaagagtacaaaagtagattattcattttgcgcaagtgaaatagaaggtgatgtggat
acttgtttaggcatagaatcaaataataatttaacaattcataataatgcttatgtagga
gatataccattggaattcgtgtctaataagtcttttcagaataacactattacttcatca
gtaacaaatttaactaataaaatattagaatcaagattacgtgaaatagttagtcgtgat
ccattatatgaattatgtgaacaagaaaaagattatttatggcgtggtcgttactggtgt
ttaaataatttaccttcagcattaccatggatatgtcaagttgttaattggtgtggtcgt
gaaacgttagcagaattctacactcttatacatcaatggccacaaccatttaatgttgac
atagctttacgtttacttggtgcattcgatttaacaagaagtaattcaaatcttattgat
ttaccaaatggaattaaagttggagcaagtggaatagctgattcatatttacgtgaatta
gctgtaaatagtttgtataatcttagtgatgctgaattgagtgattatctgttacaactg
gttcaggcccttaaagctgaaacctatttggacaatgcattaactcgttttattttatat
cgtgctttaaaaaatcctctgcaaattggtttacgattgttttggcatttacgttctgaa
cttcatttgccagatatgcgccttcgattcagtctaatattggaagcattttgtcgaggt
tgtggaccaatgttagtattactttctcgtcaagtaactgctctcaatcgtttagaagcg
ttaagtacacgtttaaaagaattgactagtgaagatgaacaacgtgaactattccgtgaa
gagatatctcgaacagaaacccaacatgatcttcaatggttaccatctccgttatgctta
agtgaaatcttgggtgaattattaattcacaaatgcgatgttaagcgatctaaaaaaaaa
ccattatggcttgtatggacaaatcctgatagactggcacaatttcatcatcaaaactat
caactgatatttaaacatggtgatgatctccgtcaagatatgctgacacttcagttactc
aaattaatggatcgtatatggaaagaagaaggtatggatatgtgtttaacatcatatggt
tgttttgcaacaggttatgaaatgggaattattgaagcagtacgtgattcacgtactgta
atgtctatacaaggtgaacgtttacgttccgctttacaaattgattcatcacagttatat
aaatggttaatgcaacatgctaaacaaaaggcaagacagttaaatcattcaccattaggt
gataattctgcctatgaacgaatgatacgtacatttactatgtcatgtgctggttattgt
gttgctacatttattttgggaattcgtgatagacatccagataatataatggttgattca
actgggcgattgtttcatattgattttgggcacatcttagataatcgtaagaagaagttt
ggttttacgcgtgaacgtgtaccatttgttttgacaaaagattttattacggtaattgca
cgtggtaatcctgatgctggggcaataacaacaactaatactccatcatcagtcacccat
aatactatcggaggaatatacggtaatatgtatttccaagaattcactgatttatgtggt
aaagcttaccttcttttacgtaaacattcaaatctcatattaacattattagctatgatg
ttaccttctggattacctgagctaacttcagtgtgtgatttggaacatgtaagaaagact
ttagctgtcgaaattgataatgaacatgaagcacttgcttattttcatcataaatttaat
gaagcctattctggtgcatggacaacaaaaattgattggttttcacattggatgaataca
tga

DBGET integrated database retrieval system