KEGG   Schistosoma mansoni: Smp_166530.2Help
Entry
Smp_166530.2      CDS       T01095                                 

Definition
phospholipase A
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
smm  Schistosoma mansoni
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Smp_166530.2
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Smp_166530.2
Enzymes [BR:smm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Smp_166530.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 370 aa AA seqDB search
MIPGTAGCQAFAVLKNDPDNKTLPVWLNLELFAFIKHFTKYFKLQYDPKTGRSYDAEGVD
IVFPGWGETWSIENLDKTPNMFSKYFGSLVYVLRKDPFYVSNFTMRGAPYDFRKAPNENY
GLFDKLKALIEETYENAKQRPVVLLPHSMGCLYAQWFLKKCEIPWKKKYIKSLVFSSCPF
GGSVKTVKVEASGDNFGVFLRSPLSFRHVQRSMPSLTFLFPDSRLWPSSEPLIITPTTNY
SSADYERFFKDINYTIGYQMWKDTHSLVDGLEMPTGIDDIHCIHGSHLSTTEKIAYSAPS
FFYSGFPDQVPLLIPGDGDGTVGIRSLEYCKNWPGIKHYVLPGAEHVRILSDIRHINIIL
KILNANITHG
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgatccctggaacagctggttgtcaagcttttgctgtgttaaaaaatgatcctgataat
aagacgttacctgtatggttgaatttggaactttttgcatttataaaacattttactaag
tattttaaattacagtatgatccgaaaactggtcgcagttatgatgctgaaggtgttgac
attgtttttccaggatggggtgaaacgtggtcaattgagaatctagataaaacaccaaat
atgttttctaaatattttggttcattggtttatgttctaagaaaagatccgttttatgta
tcaaattttacaatgagaggtgcaccatatgattttagaaaagccccaaatgaaaactat
ggacttttcgataaattaaaagccttgattgaggaaacttatgaaaatgcaaaacaaaga
cccgttgtcctactgccacacagtatgggatgcttatatgctcagtggtttttgaaaaaa
tgtgagattccatggaaaaagaagtatataaaatccctggtgttttctagctgtccattt
gggggttctgtgaaaacagtgaaagttgaagccagtggtgataactttggggtatttcta
cgtagtccattaagttttcgacacgtccagcgttctatgccatctcttactttcttattt
cctgattctcgtttatggccatcatcggagccacttattataacacctacaaccaactat
agctcagctgattacgaacgtttcttcaaagatataaattatactattggctatcaaatg
tggaaagatactcactctcttgttgatggattggaaatgcctactggtattgatgatatt
cattgtattcatggttcacatttatctactaccgaaaaaattgcctattctgcacccagt
tttttttatagtggtttcccagatcaagtacctttattaattcctggtgacggagatggg
acagtcggcatacgaagtttagaatactgcaaaaattggcccggaattaaacattacgta
ttacctggagctgagcatgttcgtattcttagtgatataagacatattaacattattctc
aaaatccttaatgcaaatataactcatgggtaa

DBGET integrated database retrieval system