KEGG   Schistosoma mansoni: Smp_166530.2Help
Entry
Smp_166530.2      CDS       T01095                                 

Definition
phospholipase A
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
smm  Schistosoma mansoni
Pathway
Glycerophospholipid metabolism
Lysosome
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:smm00564]
Cellular Processes; Transport and catabolism; Lysosome [PATH:smm04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 370 aa AA seqDB search
MIPGTAGCQAFAVLKNDPDNKTLPVWLNLELFAFIKHFTKYFKLQYDPKTGRSYDAEGVD
IVFPGWGETWSIENLDKTPNMFSKYFGSLVYVLRKDPFYVSNFTMRGAPYDFRKAPNENY
GLFDKLKALIEETYENAKQRPVVLLPHSMGCLYAQWFLKKCEIPWKKKYIKSLVFSSCPF
GGSVKTVKVEASGDNFGVFLRSPLSFRHVQRSMPSLTFLFPDSRLWPSSEPLIITPTTNY
SSADYERFFKDINYTIGYQMWKDTHSLVDGLEMPTGIDDIHCIHGSHLSTTEKIAYSAPS
FFYSGFPDQVPLLIPGDGDGTVGIRSLEYCKNWPGIKHYVLPGAEHVRILSDIRHINIIL
KILNANITHG
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgatccctggaacagctggttgtcaagcttttgctgtgttaaaaaatgatcctgataat
aagacgttacctgtatggttgaatttggaactttttgcatttataaaacattttactaag
tattttaaattacagtatgatccgaaaactggtcgcagttatgatgctgaaggtgttgac
attgtttttccaggatggggtgaaacgtggtcaattgagaatctagataaaacaccaaat
atgttttctaaatattttggttcattggtttatgttctaagaaaagatccgttttatgta
tcaaattttacaatgagaggtgcaccatatgattttagaaaagccccaaatgaaaactat
ggacttttcgataaattaaaagccttgattgaggaaacttatgaaaatgcaaaacaaaga
cccgttgtcctactgccacacagtatgggatgcttatatgctcagtggtttttgaaaaaa
tgtgagattccatggaaaaagaagtatataaaatccctggtgttttctagctgtccattt
gggggttctgtgaaaacagtgaaagttgaagccagtggtgataactttggggtatttcta
cgtagtccattaagttttcgacacgtccagcgttctatgccatctcttactttcttattt
cctgattctcgtttatggccatcatcggagccacttattataacacctacaaccaactat
agctcagctgattacgaacgtttcttcaaagatataaattatactattggctatcaaatg
tggaaagatactcactctcttgttgatggattggaaatgcctactggtattgatgatatt
cattgtattcatggttcacatttatctactaccgaaaaaattgcctattctgcacccagt
tttttttatagtggtttcccagatcaagtacctttattaattcctggtgacggagatggg
acagtcggcatacgaagtttagaatactgcaaaaattggcccggaattaaacattacgta
ttacctggagctgagcatgttcgtattcttagtgatataagacatattaacattattctc
aaaatccttaatgcaaatataactcatgggtaa

DBGET integrated database retrieval system