KEGG   Schistosoma mansoni: Smp_168520Help
Entry
Smp_168520        CDS       T01095                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
smm  Schistosoma mansoni
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smp_168520
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smp_168520
   00620 Pyruvate metabolism
    Smp_168520
   00640 Propanoate metabolism
    Smp_168520
Enzymes [BR:smm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Smp_168520
Lipid biosynthesis proteins [BR:smm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Smp_168520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 701 aa AA seqDB search
MSIVSPSDLIRESAHVKSAEEHKLLSDKALCNPKEFWLGYAMKFHWQSPPSFGKCLSYNF
DCRKGPIFVKWFEDGCTNICYNILDRNVDRGFGDKVAILWEGNDPNDTNRLTYSEILVKV
KRIGKMLENFGIRKGDCVAIYMPMIPELLMTMLACARIGAVHTVVFGGFSACALADRIID
AKCSILITADGTWRGSKLIQLQSIASTAMDMCEEKGYSVRRCVVFQHVTAFPSKSTNGIS
NNVESKVGVRPASMLDVPLKDGRDYWWHDIISTIPENTDCPVEWVNSEDPLFILYTSGST
GRPKGVVHTTGGYMVYTATTFFYTFDYHEDDIYWCTADAGWITGHSYVVYGPLLNGATSV
VFEGIPTWPDPGRYWSIVDRYKVTKFYTAPTAIRTLIKAGDQYVQCYDRTSLKVLGSVGE
PINVSAWEWYYNIVGNGKCSIVDTFWQTETGGHMLTSLPGANIMKPGCATKPFFGIDARI
LSESGEDLTDKSKELGINVEGYLVFAKPWPGMMRTINNNYELFESVYFKRFPGYYVAGDG
SVLDKDGDFWITGRLDDMLNVSGHLISTAEVENALLLDPNVSEAAVVGRKHSVKGECLYC
FVTLKDTIPNDHMNGFMDVDIITQEMKSELCQMIRTKIGPFATPDYIQSAPVLPKTRSGK
IIRRILRKIANEDYEFGDTSTLLDYSCLETLIKLSKSVINQ
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgtttcacctagtgatttaatcagagaatctgctcatgttaagtcagctgaa
gaacacaaattgttatctgacaaggcattatgtaatcccaaagaattttggttgggatat
gcaatgaagtttcactggcaatcacctccttcattcggaaaatgtcttagttacaatttc
gattgccgtaaaggacctattttcgttaaatggtttgaagatggatgcacaaatatttgc
tacaatatcttggatcgtaatgttgaccgtggttttggcgataaagtggcaattttatgg
gaaggtaacgatccaaatgatacaaatcgtttgacatactctgaaatattggtcaaggtc
aaaagaattgggaaaatgcttgagaatttcggtattagaaaaggagattgtgttgccatt
tatatgcctatgatcccagagcttctgatgactatgttagcatgtgctcgtattggtgct
gtacatactgttgtatttggtgggttctctgcctgtgctcttgctgatcgaattatcgat
gccaaatgtagcattcttatcactgctgatggaacatggagagggtcaaaacttattcaa
cttcaatcaattgcgtctactgcaatggatatgtgtgaagagaaaggatattctgtacga
cgatgtgttgtatttcaacatgtcaccgcttttccttctaaatccactaatggaatcagt
aataatgttgaaagtaaagttggcgttcgacccgcttcaatgcttgatgtcccattaaag
gatggtcgtgattattggtggcatgatataatcagtactattcctgaaaatactgattgt
cctgtagaatgggtgaattcagaagatccgttatttatactttatacaagtggcagtaca
ggacgaccgaaaggtgttgtacacaccacaggtggctacatggtttatacagctacaaca
ttcttctacacgttcgattatcatgaagatgatatatattggtgtactgctgatgccggt
tggataacaggtcattcatatgttgtatatggaccattattaaacggtgctacaagtgta
gtttttgaaggcattccaacttggcctgatccgggtcgatattggtctatcgtagatcga
tataaagtgacgaaattctatacagctccaacagcaattcggacgttaataaaggctggt
gatcaatacgtccaatgttatgatcgtacatcattaaaagttcttggaagtgttggtgag
ccaatcaatgtatctgcttgggaatggtattataatattgtgggtaatggtaaatgttca
attgtcgatacattttggcaaacagaaactggtggacatatgcttacatcattacctgga
gcaaatataatgaaacctggctgtgctactaaaccgttctttggcattgatgctcgaata
ttatcggaaagtggtgaagatttaacagacaagtcaaaagaactaggtatcaatgtagaa
ggttatttggtctttgctaaaccatggcctggtatgatgagaacaatcaataataattat
gaattatttgaatcagtttattttaaacgttttcctggttattatgttgctggtgacggt
tctgtgttagataaagatggagatttttggataaccggtcgtttagatgatatgttgaat
gttagcggtcatcttattagtactgcagaagtagaaaatgctcttctattagatccaaat
gttagtgaagctgctgttgtcggtcgaaaacattcagttaagggtgaatgtttatattgt
tttgttacattgaaagatactataccaaatgatcatatgaatggtttcatggatgttgat
ataattacacaagaaatgaaatcagaattatgtcaaatgatacgaacaaaaattggacca
tttgctactccagattacattcagagtgcccctgtgctaccaaaaacacgtagtggtaaa
attataagacgtattttacgaaaaatagctaatgaagattatgaattcggtgatacatca
actttattggattattcttgtttagaaactttaattaaattatcaaaatccgtcataaat
caataa

DBGET integrated database retrieval system