KEGG   Schistosoma mansoni: Smp_168670Help
Entry
Smp_168670        CDS       T01095                                 

Definition
serine/threonine protein kinase
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
smm  Schistosoma mansoni
Brite
Enzymes [BR:smm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Smp_168670
Protein kinases [BR:smm01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   Smp_168670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 1183 aa AA seqDB search
MNSELQPIIMNSHLDSNYATGTPTNLSSTNQAEISFGSNNNSNSYIALLRNSSFINKSLS
LVEKFKMGSMLSELNTTNKSMGSEEHGRKFQQPSQEQEQITKPSILSRSVDLQTGIQDIS
FADNSTSKQSDSSLKHENNMKNKKLFPSNESIKDIEITRSVVKKRSPSKTIHKLHSGDKI
NSMSHSKTVHGYRDIAYISLEAAPKSNILSTSINDSSPRNIKTSSRNRSGITNFSHCQYD
NYPIFSDNDHQFGRVHNDLMESSRPHQYGTSNDCIDFKIPTVRNVVLATPSNETYPSQQN
TPYSKCWNNAVELNNLSRSCNSVLYHSPRQGNSCKVTDTERSNKLLDELHRLYIQLKEAE
NEISERDSYIRYLQSIIFRRDQLIQQLIKQVPESYIPEEYYESINELEGHTKVVHTECQK
SKQLQMYHKAVKHYDKSNVPSMNVSRWDSEHVSHYKNNRSSYLKANASGFVEQHENYSRE
NNKTNDVKIITPTPVNTTNNSPIISSNSYNKCDLPFSKLQYSKSGTLISLNNTSEYNVGN
VINSNATDGMETNDNKTPGIGMNLQIISKSRVKRNAISGESEKYLPPPASHLSNWPKIEK
PAHTKALITQAILNNDFMKHLDKRQISKIVDSMCPLGCARLSWIIQEGEVGSVVYVLEDG
YVEVQKAGERLREMGPGTVFGELAILYNCTRTASVRAITDCKLWAIDRPCFQSIMMFTGI
QKQTEYVKFLKSVPTFKDLNLEVLGKVAVVLGSEHYEPDEYVIREGERGNTFYIITGGKV
KVTKNRGNECNEQFIRYMTRGDWFGEKALTDEDVRTANIIAMPPRGVDCLMLDRDSYNVL
IKDLVSFERSYPDEKPTISQREKQFSDIKLTDFTVVSTIGIGGFGRVQLVYLNKDKRQCF
ALKKLKKHYIVETKQQEHVINEKNILMETNHEFIVKLYRTYKDQRYLYILLEVCLGGELW
TLLRNSTAFDDSTARFYSACVVEALNYLHRRGIVYRDLKPENLLLDSQGFCKMTDFGFAK
RIGYGNKTWTFCGTPEYVAPEVILNKGHDFTVDFWALGILMFELLTGTPPFTSSDPMKIY
NIILKGINTIEFPKSITRNAQCLIKKLCRDAPAQRLGARKSGIIEVKNHAWFEGFDWNGL
IARTIQVPITPKISSPTDLSNFDSYSEEEELPPEDTTGWDKDF
NT seq 3552 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagaactacaaccaattatcatgaattctcatttagattccaattatgcaact
ggcacacctactaacttatcatcaaccaatcaagctgaaatcagtttcggctcaaacaat
aactctaattcatacatagcattactaaggaattcctcatttattaataaaagtttaagt
cttgttgaaaaatttaaaatgggatcaatgttatctgaactgaatacaacaaataaatcc
atgggaagcgaagaacatggacgaaaatttcaacaaccatcacaagagcaagaacaaatc
actaaaccctcaatactttcacggagtgttgatttacagacaggaatacaggatatttca
tttgccgataattcaacttcaaaacaatctgattcttcattaaaacatgaaaataatatg
aagaacaagaaattatttccttcaaatgaatcaatcaaagatatagagataacacgatca
gtagttaaaaaacgttcaccatcaaaaacaattcacaaactacattcaggtgataaaata
aactcaatgtctcattcaaaaactgttcatggttatagagacatagcatatattagcctt
gaagctgcaccaaaatcaaatattttgtcgacgtctataaatgactcatcaccaaggaat
ataaaaacatcaagtaggaataggtcagggattactaatttcagtcattgtcaatatgat
aactatccaatattcagtgataatgaccaccagtttggacgagttcataatgatcttatg
gaaagcagtagaccacatcaatacggtacttcgaatgactgtattgattttaaaatacct
accgtaagaaatgttgttttagctactccttctaacgaaacatatcctagtcagcagaac
actccatactctaaatgttggaataatgccgttgaacttaataacttatcaagatcttgt
aattctgtattatatcattcaccaagacaaggaaactcttgtaaggtaacagatacagaa
aggagtaacaaattacttgatgagttacacagattatatattcagctgaaagaagcagag
aatgaaatttctgaacgagactcttatatacgttacttgcagagtatcatattcaggcgt
gatcaactgattcaacagcttataaaacaagttcctgaatcatatattccggaagaatac
tatgagtccatcaatgagttggaaggacatacaaaagttgttcatactgaatgtcaaaaa
tcaaaacaattacaaatgtatcataaagctgtaaaacattatgataaatcaaatgtaccc
agtatgaatgtatcaagatgggattcagaacatgtatcccattataaaaataacagaagt
tcatatcttaaagctaatgcttctggatttgttgaacagcatgaaaattattctagagaa
aataataaaacaaatgacgtgaaaataataacacctactccggttaatactactaacaac
agtccgattataagtagcaattcttacaataaatgtgatttaccgtttagtaagttacag
tattctaaatcaggtacacttattagtttgaataataccagtgaatataatgttggaaat
gttattaacagtaatgcaacagatggaatggaaacaaatgataacaagacaccagggatt
ggaatgaatttacaaattatatctaaatcacgtgttaaacgtaatgctatatctggtgaa
tcagaaaaatatcttccacctccagcaagtcatttgtcaaattggcctaaaattgagaaa
ccagcacatacaaaggcgttaattactcaagctattctgaacaatgactttatgaaacat
ttagataaaaggcaaatatctaaaattgtggattcaatgtgtcctttgggctgtgctaga
ttgtcatggattatacaagaaggtgaagttggttctgttgtttatgttttagaagatggc
tacgttgaagtacaaaaagctggtgaacgtttgcgtgaaatgggtccaggtacagttttt
ggagaattggctattctgtacaactgtacaagaacagctagtgtaagagcaataaccgat
tgtaaattatgggcaatagatcgtccatgttttcaatcaattatgatgtttacagggata
caaaaacaaacagaatatgtgaaatttctgaaaagtgtcccaacatttaaggatttaaat
ttagaagttcttggtaaagttgctgttgtacttggatcagaacattatgaacctgatgaa
tatgtcattagagaaggagaacgtggaaacacattttacattataacagggggaaaagtg
aaagtgacaaaaaaccgtggcaatgaatgcaatgaacaatttattcgttatatgacacgt
ggtgattggtttggagaaaaagctttaactgacgaagatgttcgtaccgcaaatataatc
gcaatgccaccacgtggtgtagattgtctaatgctggacagagattcatataatgtactc
attaaggatctagtcagctttgaacgaagctatccagatgaaaaacctactattagtcaa
agagaaaagcaattttctgacatcaaacttaccgacttcactgttgtatcaacaatcgga
atcggtggttttggtcgtgtacaactggtttatttaaataaagataaacgacagtgtttt
gcattgaaaaaattaaagaaacattatattgtagagacaaaacaacaagaacatgttata
aatgagaaaaatattttaatggaaacaaatcatgaatttattgtgaaattataccgaact
tataaagatcaacgttatttgtacattttattagaagtttgtctaggtggtgaactgtgg
acactgttacgtaattctacagcttttgatgattcgacagcaagattttattcagcatgt
gtagttgaagcattaaattatttgcatagaagaggaattgtttatcgtgatttaaaaccg
gaaaatttactgttagacagtcaaggtttctgcaaaatgactgatttcggttttgcaaaa
cgaatcggatacggcaataaaacatggacattttgtggaactccagaatatgtagcacct
gaagtgattctgaataaaggacatgatttcactgttgatttttgggcacttggtatttta
atgtttgaattactaactggaacacctccatttacttcatccgacccgatgaaaatatac
aatattatacttaaaggaattaatacaattgaatttccaaaatctattacaagaaatgca
cagtgccttattaaaaagttatgcagagacgctccagcccagcgactcggtgctcgaaaa
tcaggaataatagaagtgaaaaatcatgcatggtttgaaggattcgactggaacgggctt
attgctagaactattcaggttcctattacaccaaaaatttcctcaccgacagatttatca
aactttgacagttattcagaagaagaagaattgcctccagaagatacaaccggttgggat
aaagatttttaa

DBGET integrated database retrieval system