KEGG   Schistosoma mansoni: Smp_168800.2Help
Entry
Smp_168800.2      CDS       T01095                                 

Definition
family C12 unassigned peptidase (C12 family)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
smm  Schistosoma mansoni
Brite
Enzymes [BR:smm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Smp_168800.2
Peptidases [BR:smm01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Smp_168800.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 194 aa AA seqDB search
MLVDVTCCSFKMYLQMAVFYLFQSFKETIIMRWIPLEANPQVLNEYMNKLGVVEESWKFI
DIFSLDDDMLAFVPEPVISLLFLYPLETPIENASLGVEDNSSKVVLIKQTVGNACGTIAL
LHAIVNNKQKLSIKDGSFLSSVLEDFENKTPAERGVIVESKKEISALHEKSALEGQTEAP
NAESKTNLHFXMFC
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtagatgtcacttgctgtagcttcaaaatgtatcttcaaatggctgtcttttat
ttatttcagagttttaaagaaacaattattatgaggtggatccctttagaagctaatcct
caggtgctaaatgaatatatgaataaacttggagttgtcgaagagtcatggaaatttata
gacatttttagtttggatgatgatatgcttgcatttgtaccagaacccgtgataagccta
ttatttttatatccccttgaaactcccattgaaaatgcttcattgggtgtcgaggataac
tcatccaaagttgttttgatcaaacaaacggttggtaatgcttgtggaactatagcttta
ttacatgctatagtaaataataaacaaaaactaagcatcaaagatggttctttcttgagc
agcgttttagaggatttcgaaaataagacacccgctgaacgtggagttatcgtggagagt
aaaaaggaaatttccgcgttgcatgaaaagtcagcactagaaggtcaaacagaagcacca
aacgctgagtcaaaaactaatttgcactttngtatgttttgttga

DBGET integrated database retrieval system