KEGG   Schistosoma mansoni: Smp_171610Help
Entry
Smp_171610        CDS       T01095                                 

Definition
dual specificity serine/threonine tyrosine kinase
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
smm  Schistosoma mansoni
Brite
Enzymes [BR:smm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Smp_171610
Protein kinases [BR:smm01001]
 Serine/threonine protein kinases: Other group
  TTK family
   Smp_171610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 610 aa AA seqDB search
MMLLPSVSRDLQIAIVKAYPKNIKSCDDWLSFLNHMERKVRSLDRGSTTTNILLNLYESA
IDSLDVNWSDEMYLTIFIRRAVLASYENSDCGPVLLSLCSINGRRNPQLIAAVAYYYFKQ
GKHMIIISSLKFPGDKNRAKGLLNSTKKCVDTCGVELLCRAESMLDTDDDFKSLLGPFYY
KPDFDFQDINCSQASSSGVSSVLDSTCPNDHTEERYQSVTDINFEPNGNSPNIPSNCNPV
ESIQIIGPVRDLSNSSRSFKSSGLPEELSVTSVTSNPNMKSLQQPELSTIVGSIKLNGSC
EKVFSLDSDKKLISVSVQTELVNESDQFITVNGKKYRVINELGRGGSSVVYWAMDSDLNP
WAVKKVDLKNLTQETVTSYINEIEMLKSLINSDRIIRLHDYHCTSENLILVMEKGDCDLK
SVILSFWSGGARKPSRSPSGMLTSGIVFYWDQMLRCVKALHDRRIVHLDLKPQNFVLVYG
QLKLIDLGISRLLPDDSTTVNHWLKLGTLSFMSPEQLEEAAVGRKSDIWSLGVILYMMVY
GQLPFNQDKLHSRLSAIINPSVKISLPAIKNKSIYKALERSLVRNHLERASVDELLSYEY
VSSTSAADSW
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgatgctacttccaagtgtatcacgagatttgcagatagcaattgtaaaagcttaccct
aaaaatataaaatcttgtgatgattggcttagctttcttaatcatatggaaagaaaagtt
agatcattggatcgagggtcaacaacaactaacatacttttaaatttatatgaaagtgct
atagattcattagacgtgaattggtcagatgaaatgtatcttacaatttttatcagaaga
gcagttttagcatcatatgaaaattcggactgtggtcctgtacttctaagcttatgttct
ataaatggacgtcgaaatccacagttgattgccgctgtagcgtattattatttcaagcaa
ggtaagcatatgattattattagctcattaaaatttccaggagataagaatagagctaaa
ggtcttttaaactctacgaaaaagtgtgtcgacacatgtggggtggaactgttatgtaga
gccgaaagtatgttagatacagacgatgatttcaaatcgttattgggaccattttattac
aaaccagactttgattttcaagacataaattgttctcaggcaagttcaagtggagtttct
tcagttctggattctacttgtccaaatgatcacacagaagaacgttatcagtctgtaaca
gatatcaattttgaaccgaatggaaattcaccaaacattcctagtaattgcaatccagtt
gaatcaatacaaataattggtccagtcagggatttatctaattcttcccggtccttcaaa
tcatcagggcttccagaagaactgtcagttacttcagtcacaagtaatccaaatatgaaa
tcattacaacagcctgaattatccaccattgttggttctattaaattgaatggaagctgt
gaaaaggtgttttcacttgattcggataagaaattgatttctgtcagtgtgcaaactgag
ctggtcaatgaaagtgaccaatttataactgttaatggtaaaaagtatcgagtaattaat
gaattgggacggggaggttcatcggtggtgtattgggctatggactccgatttaaatcca
tgggcagtgaaaaaagttgatttgaaaaatcttacacaagaaacagttacgtcgtatata
aatgagattgagatgcttaaaagtttgataaattctgacagaattatccgactacatgat
tatcactgtacatcagaaaatctcatacttgttatggagaaaggagattgtgatttgaaa
agtgtcattcttagcttttggtctggtggtgcacgaaaaccgtctcgttcaccatcaggt
atgcttacatctgggattgtattctattgggatcaaatgttgcggtgtgtgaaagcactt
catgatcgtcgtattgttcacttagatttaaaaccacaaaactttgttctagtctatgga
caattgaagcttattgatttggggattagtcgtctgttaccagatgattcaacgactgta
aaccattggttgaagttgggaactttatctttcatgagtccagaacaattggaagaagct
gctgttggtcgtaaatcggatatttggtcattaggtgtaatcctttatatgatggtctac
ggtcaattaccatttaatcaagacaaacttcactctcgtctatcagcaattataaatcct
agtgtaaaaatatctttaccagctatcaagaataaatctatttataaggccttagaacgg
agtttagttcgaaatcatttagaaagagcatctgttgatgaattgctgagttatgaatat
gtgtccagtacgtcagctgctgactcatggtag

DBGET integrated database retrieval system