KEGG   Schistosoma mansoni: Smp_171820.1Help
Entry
Smp_171820.1      CDS       T01095                                 

Definition
neuropathy target esterase/swiss cheese-related protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
smm  Schistosoma mansoni
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Smp_171820.1
Enzymes [BR:smm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Smp_171820.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 1638 aa AA seqDB search
MQLFSTACDRVSSLSSNIYETFYDLINKFTLFYAGVLISIREGILAEIFPSLLLSYNATV
LLILTIFLLGLSTFLLLRHLKSHVPLRAKITQVPRGFRRRDKIRYHAIRFGRKFSEITEE
LKKVQTKEERRTTIINFARKIFKLHDVGKSPTLAYGRLPESFFEPDEEDVSSLPEDLRLM
ISSIRVFGQLEKSFFIRFCKFIETIELNVGDCLFRIGDEDKCVYVIRSGRIQITVTEPDG
SKCTIAEVGKGGSVDSLLSVLSILTGYPSTFEFMEAVALEPTTVLCLPARSFLEICKTQT
PLFRIIQMIAVRLQRLSFNALHTYLGLSSELINKDFSPISGSSEAYEFLCNIFEKKPSMK
DFNEFGNISLRYPDLDLTCSKVKFSMSYVTDDQKSKNSESELEQVFTYNDDLNLDSMSQS
GALELGESPIFYSRKRTSSPMYSPSQPPSPNCKHRSTNLRRARSLADTSCKLQLNCDDVN
DVIKDIGNENNKGEPSDFVKDVSFTKSELKEMIKFAEKDLSNLLNLTDTSILHGHVSLTT
VSSDFILSRECEMQLEMYYVIFGELRAFQSTNDGPNNDVITMFKCGPGKAVGLLGLITGE
PNIYGIQATTKAIVAVLSRETFYSVVRQYPKALFSVTHIISSHLSPLFHQLDFAMEWLSV
KSGKALYKKGDVSNHVYVVLSGRLRQVDNMPDGGHRIVSELGRGDLVGFLEVISQQPRIS
TVMAIRDSELAQIPSHLLHHLKNKFPQVLTRIIQLLSDKLLGNLTTSSSTASQLGMPLLH
MTSTNSLVTGGLGYTTGGNSKLDVLYSPLNSGVMTNLRTIAVLPTTTDINAEAFTLELQH
SMSSMGSSVRLTSDIVLKRLGSCAFDSVNQYRLSTWLSHQEDSHRIVFFVCDCQRVSAWN
RICIRQADCILVLALHSSDPARPSPIEMVLKNDPTKVAKVLILMYPLDTDYPESGKTAVW
LNARPWISQHYHIRCEPRVFIPRSKLNLINFYTKVFAREKPNPLSDFSRLARYLVGEAVG
LVLGGGGARGCSHVGLIHSVDKINCSLHILSPKLIYVGITSFIIENYSLVILVKSLFCII
DNFNVMCSSKELNRQLQSIFHDRQIEDFWLPFFCVTTDITNCKMRIHTQGSSWRYVRASM
SLSGYLPPLCDPYDGSLLLDGGYTNNLPADVMVCFGAKTIFANDVGAAVETELTNYGDHL
SGWYLLYNRYFRVGTPVLRIPSLTEIQARLAYISCVRQLEYIKASGICFYLRPPIDKYLT
LQFSAFDEINSFSDQLTFIDLAECVAKTSKGVNSPGSDKYHRTDSTNVQNFSQLPDMAGK
NTINDISTYNNAPDSSGGSITTVRKLPKSTHTVVSDSTSRYFDTDHCLQSGSSSKISSSN
EQYRKEEQKHISDFLENNLSSKCRRRFLSGCYDVRSSYLYRNLNILCDVNCAPIQNNLIK
SGVHPNHLRKCKSDYGLQAYDNSQTMNLIMNSDVDPVVNASARSAHVTKYSLSSFRSLED
DGYLEDDESSTDSAHSPVTASDPELRHDVYPESSNAEEKGLRQRSSSTYGLPPYLLHTEA
TNKRCDSPNSDNNVKNPSLMKGQQGSNDVFTNNPLLKLDMTSVRNRTKPNRKRHHRSSLD
RLRTDRDRGAANSLVNLP
NT seq 4917 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttttcagcacagcttgtgatagagtatcctctctcagttcaaatatttatgaa
acattctatgatcttattaacaagttcactttgttttacgccggagtccttataagtata
agagaaggtattttggcagaaatattcccgagccttcttttgtcgtataatgctaccgtc
ctccttatacttactatatttttgctgggtctatcgacattcttactattacggcacttg
aagtctcatgtgcctttgcgtgctaaaatcactcaagttcctcgaggattccgacgaaga
gataagatcaggtaccatgcgattaggttcggacgcaaattcagcgaaataacggaggag
ttaaaaaaggtacagacaaaggaagaacgcagaaccacgatcataaatttcgcgagaaaa
atcttcaagttgcatgacgttggaaagtcgccgacgctggcctatggtcgactacctgag
tcgttttttgaaccagatgaagaagatgtctcttcattacctgaagatctccgcttgatg
ataagttcgatacgagtttttgggcaactggaaaaatcattttttatcaggttttgcaag
ttcattgagacaattgagctgaatgtaggcgattgtctgtttcgtattggagatgaggat
aaatgtgtatatgttattcgtagtggtagaatccaaatcactgtcacagaaccggatgga
tccaaatgcaccatcgctgaagttggaaaaggtgggagtgttgatagtttgctatctgtt
ctgagtatacttactggttatccttcaacttttgagttcatggaagcagtagctttagag
cccactactgtattatgcctaccggcccgatcatttttggaaatatgcaaaacacaaaca
cctcttttccgcattattcaaatgattgcagttagacttcagcgtttaagctttaacgcg
ctacacacttatcttggtttgagttcggaactaattaataaggacttttctcctatttct
ggttcatctgaagcctacgaattcctatgcaatatttttgaaaagaaaccatcaatgaaa
gactttaacgaattcggtaatattagtttaaggtatccagatttggatcttacgtgttca
aaagttaaattttccatgtcatatgtcacagatgaccaaaagtctaagaattctgaatca
gaattagaacaggttttcacctataatgatgatttgaatttagattcaatgtctcaatct
ggtgcacttgaattaggtgaaagtcctatattctacagtcggaaaaggacatcatctccc
atgtattcaccttctcaaccacctagtccaaattgtaaacatcgttccactaatttacgt
cgggcacgttctcttgcagatacatcctgtaaacttcaattaaactgtgatgatgtaaat
gatgtgataaaagacattggtaatgaaaataacaaaggggaaccttctgattttgttaaa
gatgttagttttaccaaaagtgaattaaaagaaatgataaaatttgctgaaaaagattta
tctaatttattaaatttaaccgataccagtatcctgcatggacacgtttcacttactact
gtttcgtctgattttatactttcaagagaatgtgaaatgcaattagaaatgtactatgta
atatttggagaattgagagctttccaatcaactaatgatggacctaataatgatgtcatt
acaatgtttaaatgtggaccgggaaaggcggttggacttttgggactgataaccggtgaa
ccaaatatttatggcatacaagctactacaaaagctattgtagctgttttatcccgtgag
acattttactctgtagttcgtcagtatcctaaggctttgttcagtgttactcatattatt
tcttctcatttatcaccgttatttcatcaacttgattttgctatggaatggttgtctgtt
aagtcaggaaaggctttatataagaaaggagacgtctcaaatcacgtttatgtagtttta
agtggtcgattaagacaagtcgataatatgcctgatggaggtcatcgtatagtcagtgaa
ttggggcgtggtgatctcgttggttttcttgaagtcattagtcagcaaccacgaatatct
acagttatggcgatcagagattcagaattggctcaaatcccctcacatttactccatcat
cttaagaataaatttccacaagttttaactcgtattattcaattattatcggataaatta
ttggggaatttaacaactagttctagtacggccagccaattgggtatgccacttctacat
atgaccagtacaaattctttagttaccggtggattaggttatacaactggtgggaattct
aaattggatgttttatatagtccattgaatagtggtgttatgactaatctacgtacaatt
gctgtattacctactacaacggatattaatgctgaagcgttcactttggaattacaacat
tctatgagttcgatgggatcatctgttcgtcttacttcagatatcgtactgaaacgttta
ggttcatgcgcattcgatagtgttaatcagtatagacttagtacttggttaagtcatcaa
gaagactcacatcgtattgttttcttcgtttgtgactgtcagcgggtttcagcctggaat
cgtatatgcattcgtcaagctgactgcattttggttttagctttgcattcgtctgatcca
gcgcgtccgtcaccaatagagatggtattaaaaaatgatccgacgaaggttgccaaagta
cttattcttatgtatcctttagatacagattatccagaatccggtaaaactgcagtatgg
ttaaatgctcgaccatggattagtcaacattatcatatacgttgtgaacctcgtgtattt
atacctcgttcaaagttgaatcttatcaatttttatactaaagtatttgctcgtgaaaaa
cctaatccactttctgatttctctcgtcttgctcgttacttagtaggtgaggctgttggt
cttgttctaggtggtggaggagcaagaggttgttcacatgttggactgatacattctgta
gataaaatcaactgtagtttacacatccttagtccaaaacttatatatgtagggattact
tcgtttattatagaaaattatagtctggtcatattagttaaatcattgttttgtattatt
gataattttaatgtcatgtgtagcagtaaagaacttaatcgtcaacttcaatcgatattt
catgaccgtcaaattgaagatttttggcttcctttcttttgtgtaacaacagatataact
aattgtaaaatgcgtattcatacacaaggatcgtcttggagatatgtacgtgcaagtatg
tcattatctggttatttaccaccattatgtgatccttacgatggaagtttattgttggat
ggtgggtatactaacaatctaccagctgatgtaatggtatgtttcggtgcgaaaacaatc
tttgctaatgatgttggggctgctgtagagacagaacttacgaattatggtgatcattta
tcgggttggtatttgttatacaatcgatatttcagagttggcactcctgtactacgtatc
ccaagtctaacagaaattcaagctcgtctagcttatatttcttgtgttcgacagttggaa
tatataaaagccagtgggatatgcttttatctccgaccaccgatcgataagtatttaact
cttcaattctctgcgtttgatgaaataaatagttttagtgatcagctcacattcattgat
ctagctgagtgtgtagctaaaacatccaaaggtgtgaattctccaggttctgataagtac
catagaacagatagtaccaatgtacaaaatttctctcaattacctgatatggctggtaaa
aatactataaatgatatttctacttataacaatgctcctgattccagtggtggcagtata
actactgtgaggaaacttccgaaatctacgcacactgttgtttcagattcaacatcaaga
tattttgatactgatcactgtttacagtctggatccagttcgaaaatttcatcctcaaat
gaacaataccgcaaggaagaacaaaagcatatttccgactttttggaaaataatctgtct
tccaagtgtagacgacgtttcctaagtggttgttacgatgtcaggagcagttacttatac
cgaaatttaaacatcttatgtgatgtgaattgtgcaccgatccaaaacaatttgattaaa
agtggtgtccaccctaatcatttacggaaatgtaaatctgattatggtctacaagcgtat
gacaacagtcagacaatgaatttaataatgaatagcgatgtcgacccggtagttaatgca
tctgcgagatctgcacacgttactaaatacagtctgtcttcctttagatctttggaagat
gatgggtatttagaagatgatgaaagttccacggacagtgcacattctccagttacagca
tctgatcccgaattaagacatgatgtttaccccgaatccagtaatgcagaagaaaagggt
ttgcgccaaagatcatcttctacctatggacttccaccttatttgttacatacagaggcg
acaaataagagatgtgattcaccgaattctgataataatgtgaaaaatccatccctcatg
aaaggtcaacaaggaagcaatgatgtgtttaccaacaacccattgcttaagttagatatg
acatcggtacgtaatcggaccaagccaaatcgcaaaagacatcaccgttcatcattagat
cgattacgaactgatcgtgatcgaggagcggcaaactcgcttgttaacctgccatag

DBGET integrated database retrieval system