KEGG   Schistosoma mansoni: Smp_172110Help
Entry
Smp_172110        CDS       T01095                                 

Definition
shc transforming protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
smm  Schistosoma mansoni
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:smm00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Smp_172110
Enzymes [BR:smm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Smp_172110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 363 aa AA seqDB search
MYRWTVLFLLLSPALCLFNTNDDVIKLTDQNFDKVISSKELWFIMFYASWCGHSKNAAPD
WKLFATNFKGIIKVAAVDSENNPTVTQRFSVKGFPTILIFGDNKNSPKPYTGGRDIDHLN
KEALRELTSLVKTRTGSGSSDGSDKDDVIELTDSNFDEKVLNSQEPWLVEFFAPWCGHCK
NLKPHWDKAARELKGTVKVAALDATVHSRMAQKYGIRGYPTIKFFPAGPKTDDPIDYDGA
RSSDAIVAWAMEKADASAPAPEIVELTSATLKHSDLENVLDIGGSGYPAMVAVHGRKKKR
TTLRGAYSSTGVHDFLRQLSVGGSNLPLYDVSSLPEIKTVEAWDGKDAPPTEEQDYDDLK
VEL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgttggacagttcttttcctgctgttaagtccggcactttgtctcttcaatacc
aatgatgatgttatcaaactcacagaccaaaactttgacaaagtaatatcaagcaaggaa
ctatggtttattatgttctatgcatcttggtgtggacacagtaaaaatgctgctccggat
tggaaactattcgccactaattttaagggtattataaaagttgctgcggttgattcagaa
aacaaccctacagtaactcaacggttctctgttaagggctttccaacaattttgatattt
ggagataataaaaacagtcctaaaccatatacaggtggtagagatattgatcatctcaac
aaagaggctttgcgagaacttacttctttagtgaaaacaagaactggttctggatcctct
gatggctctgacaaagacgatgtaatagagcttacggacagcaatttcgatgagaaggtt
ctcaacagtcaagagccgtggttggtagaatttttcgccccttggtgtggtcattgtaaa
aatttaaaacctcattgggacaaagcagctcgtgagttgaaaggaactgttaaagtagcc
gctttggatgctacggttcatagtcgaatggctcagaaatatgggattcgaggttatcct
accatcaaatttttccctgctggaccgaaaacagatgaccctattgattacgatggtgct
cgaagttcagatgcaatcgttgcatgggctatggaaaaagccgatgcttctgctccagca
ccagagattgttgaattgacttcagcaacactcaaacattctgatttagaaaatgtactc
gatattggaggttcaggatatcctgctatggttgctgtacatgggcgtaaaaagaaaagg
actactttacggggagcatacagctcgactggtgtccatgattttctaagacagctttca
gttggcggttcaaatcttcctctgtacgacgtgagttcgttacctgaaataaaaactgtt
gaagcctgggacgggaaagacgctccgcctactgaagaacaagactacgacgatttaaaa
gtagaactataa

DBGET integrated database retrieval system