KEGG   Schistosoma mansoni: Smp_172240Help
Entry
Smp_172240        CDS       T01095                                 

Definition
(RefSeq) serine/threonine kinase
  KO
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
smm  Schistosoma mansoni
Pathway
FoxO signaling pathway
Mitophagy - animal
Autophagy - animal
Protein processing in endoplasmic reticulum
Wnt signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:smm00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Smp_172240
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Smp_172240
   04068 FoxO signaling pathway
    Smp_172240
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Smp_172240
   04137 Mitophagy - animal
    Smp_172240
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Smp_172240
Enzymes [BR:smm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Smp_172240
Protein kinases [BR:smm01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Smp_172240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
GeneDB: 
Position
6
AA seq 381 aa AA seqDB search
MYINSRMANNIPPGYHVEVVGDARFVVPFRYSNLKPIGSGAQGFVVAAYDSVLKQDVAIK
KLARPFQNVTHAKRAYREFVLMKLVNHKNIISLLNAFTPQQTLQDFQDVYLVMEFMDANL
CQVINLDLDHERTSYLLYQVLCGVKHLHAAGIIHRDLKPSNIVVKHDCSLKILDFGLART
AGDSFLMTPYVVTRYYRAPEVILGMGYSENVDIWSVGCIFAEMVLERILFPGYDHIDQWT
KITEELGTPGPEFMNRLEYAVRNYVMSRPKNEPRSFTELFPDDRFPPPSTEHETLNAEQA
RDLLSRMLVIDPLQRISVDDALHHPYIHVWYEDSEVNAPPPAPYDDSFGERNLSVEEWKA
RIFHEVKEFEAQESHIRNIQN
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtacataaactcaagaatggcaaacaacattcctcctgggtatcatgtcgaagttgtg
ggagacgctagatttgtggtaccttttcggtactctaacttaaagcccatcggttctgga
gctcagggctttgttgtagctgcctatgattcagtactcaaacaagatgttgccattaaa
aaattggctcgtccttttcaaaatgttacacatgccaaacgtgcctatcgtgaatttgtc
ttgatgaaactggtgaatcacaaaaatatcatatcattattaaacgcatttactcctcaa
caaacattgcaagactttcaagatgtttatttggtgatggagtttatggatgccaattta
tgccaggtgatcaaccttgatttagatcatgaacgaacctcatatctactatatcaagtc
ctatgtggtgtaaaacatttacatgcagccggtataatccaccgagatttaaaacccagt
aatattgttgtgaaacatgattgtagcttgaaaattctggatttcggtttggctcgtaca
gctggtgatagctttttaatgactccatatgtggtaactcgttattatcgtgctccagaa
gttattttaggtatgggttattctgaaaatgtagatatttggtcagttggttgtatattt
gctgaaatggttctggaaagaattctgttccccggttatgatcatattgatcaatggact
aagattacagaagaacttggaacaccaggacctgaatttatgaatcgtttagaatatgct
gtccgtaattatgtaatgtcacgtcctaaaaatgaaccacgttcatttactgaactcttt
ccagatgatcgttttcctccacctagcacggagcatgaaacactaaacgctgagcaagct
cgagacttattaagtagaatgttggtgattgatccattacaaagaatttcagttgacgat
gctcttcatcacccatacatacacgtatggtatgaagactctgaagtaaacgcgccacca
ccagctccatatgatgattcatttggtgaaagaaatttatcagttgaagaatggaaagct
cgtatatttcatgaagtcaaagaattcgaagctcaagaatctcatatacgtaatattcaa
aattaa

DBGET integrated database retrieval system