KEGG   Schistosoma mansoni: Smp_175230Help
Entry
Smp_175230        CDS       T01095                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
smm  Schistosoma mansoni
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Smp_175230
   00670 One carbon pool by folate
    Smp_175230
Enzymes [BR:smm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Smp_175230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
AA seq 186 aa AA seqDB search
MRLNVVVAVSENWGIGKGGGLPWKIKKDMEFFKTVTTKAHPGLKNAVVMGRVTWESIPES
FKPLKDRINIVVSSTLSHAPSFVQVVPSLNAAIDLLYNEEFSSIVDEVFIIGGYRLYKEA
LKQSIYPVRIYCTHILSEVDCDTYFPKVDWDKLKKVDLPDIPADTFTENGFTFKFCVYDV
PSEQFI
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctaaatgttgttgtggcagtttctgaaaactggggtatcggaaagggtggaggg
ttaccttggaaaataaagaaagacatggagtttttcaaaacagtaacgaccaaagctcat
ccaggcctcaaaaatgcggttgttatggggagagttacatgggaatctataccagagagc
ttcaaaccactaaaggataggattaacatagtggtatcaagcacgctatcacacgcacca
tcgtttgttcaagttgttcccagtcttaatgcagcgattgacttgttatataatgaagaa
ttcagctctatagtagatgaggtttttattatcggtgggtatcgtctttacaaagaagcc
ttaaaacagtccatatatccggttcgtatctattgtacgcacatactaagtgaggtggac
tgcgacacttatttcccaaaagtcgattgggataagctgaaaaaagttgatctacctgat
ataccagcggatactttcacagagaatggatttacgttcaaattctgtgtttatgacgtc
ccatcggaacagtttatataa

DBGET integrated database retrieval system