KEGG   Schistosoma mansoni: Smp_178700.1Help
Entry
Smp_178700.1      CDS       T01095                                 

Definition
(RefSeq) histone acetyltransferase type B catalytic subunit
  KO
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
smm  Schistosoma mansoni
Brite
Enzymes [BR:smm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Smp_178700.1
Chromosome [BR:smm03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Smp_178700.1
   HAT complexes
    HATB complex
     Smp_178700.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 435 aa AA seqDB search
NMMDSLNTRSLDDYRVNACDAIQFKLVRDKEAIDSADTFNPEFTHQIFGESEQIFGYRDL
KVGIFYTADSLSTYIDISYTSKVDPQLSKGVMPDDIMHILSGVYPYNISKNMSDFLKNFD
EKFTFTPYGVNRYNYQIMKDRCQKKFSIFFIEHGMPGFEKFLEYHKRMESFLLFFIDGAS
AISTEDIQWCYYMIYENIGQTDDGKIKYGFIGYMTVYKFYAYPKNLRPRVSQVLILPPFR
NNGHATQLLQTFYRDFVPMSNVIDIAVEDPSPDFQRIRDLLDCKRCLETPEVMQTITQSN
GVNGQIINEKSSAIRFREISRTKLKLNRCQSRRVYEILRLFLLPRTDEYVKSFSDALTKR
ATAYFQRVRPDAMRGSSLVPKTSGSSYNPLKKAFDEAADEYFESQLHEEVSTLLKNYQDT
VYKLDRFVSSLKKQS
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
aatatgatggacagtttaaatacaagaagtcttgatgactatcgtgtgaatgcttgtgat
gccatccagttcaaactagttagggacaaggaagctattgattcagcggatacattcaat
cctgagttcactcatcaaatctttggtgaaagtgaacagatattcggataccgtgatctc
aaagttggcatattttacacagcagactctctatcaacatatattgatatttcttataca
tcaaaagttgatcctcaactctccaaaggtgttatgcctgacgatattatgcatatatta
tctggtgtttatccatataacatcagtaagaacatgagcgactttttgaaaaacttcgat
gaaaagtttactttcactccatatggagttaacagatataattatcaaattatgaaagat
agatgtcaaaaaaaattttctatttttttcatcgagcacggtatgcctggatttgagaaa
ttccttgaatatcacaaacggatggaatctttccttcttttcttcatagatggtgcatct
gccatatctacggaagatattcagtggtgttattatatgatctatgaaaatattggtcaa
acagatgacggaaaaatcaaatatggatttattggttacatgacagtttataagttttat
gcttatcccaaaaatcttcgaccacgtgttagccaagtcctgatccttccaccttttaga
aataatggccatgctacacaacttttacaaactttttatcgtgattttgtaccaatgtcg
aatgtcattgatatagcagttgaagacccatcacctgacttccagcgtatcagagattta
ttggactgcaaacggtgcttggaaactccagaagtaatgcaaactataacacaatctaat
ggtgtgaacggacaaattattaatgagaagtcttctgcgatacgcttccgagagatttcc
aggacaaagttaaaactaaatcgttgtcaaagtcgacgagtgtatgaaatccttcgattg
tttttgttgcctcgtacagatgaatatgtgaaatcgttttctgacgcattaactaagcgt
gccactgcatactttcagcgggttcgaccagatgctatgagagggtcttctttggtacct
aaaacaagtggttcttcttataatccattgaaaaaggcatttgatgaagctgcagatgaa
tattttgaaagtcaactccatgaagaagtttctaccttattgaaaaactatcaagacact
gtatataaacttgatcgtttcgtctcttcacttaaaaaacagtcgtaa

DBGET integrated database retrieval system