KEGG   Schistosoma mansoni: Smp_179340Help
Entry
Smp_179340        CDS       T01095                                 

Definition
protein disulfide-isomerase
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
smm  Schistosoma mansoni
Brite
Enzymes [BR:smm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Smp_179340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 592 aa AA seqDB search
MENHKADQIPELSPHYSETHDDHFGGNICRMDPLLELELAKIRLAQTEREIELEQLRQKG
RERYNQVVADKVMYKSTFASPAVGILPGKDWVTMISRALDLPKREIIRFDSNPMNYWSFI
RNFEDCFDERVGFRSRYNYLIQYCDGEAKATIVHCALLEPEEGYRKVLELLEEAFGQKHI
VAYAFIDKMLNIPAIKGIDPDGLRRLSREMQVCELTLTQMDYVSDLNYTKTIECMFLKLP
LYLQREWVKVASRILKTGREPLFKDLCEVVKEQSDIANTRFIEFIDKGPWLVQFYAPWCG
FCRRLAGTYEEASRILLHTEPSIKVARLDATIYTGIAKMFDVRGFPTIKYINGTVSYTFT
GDRTVHGLVTFAQRANGPAVKHFEKSYEFEEHLKKLSSDEPFFFLIKPAISILEKTFLQV
AEQLRIFSWFFSGSLSVITSKFVTTRPLLALLILGVPALMFSGIVYLCCCLDANYATYDD
GEDDQLSNYDIYHKELSNQKIIGTDNPIGDRSIVDSNSSYLDSTSSSSSGSGISATKTIH
FQDMHNSPPRRRYHREVLRNSNKNIQNIGPVYSKDELEKRIKDSRAKLKKQA
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggagaatcataaagctgatcagattcctgaattgtctcctcactattcagaaactcat
gatgaccatttcggaggaaatatctgtcgaatggatcccttgttagagttagaattagct
aaaatacgcttagctcagacagaaagagaaatcgagttagaacagttacgtcaaaaagga
agagaacgttataatcaagttgtggctgacaaggtgatgtataagtctacatttgcctca
cctgcagttggtattcttcctggaaaagactgggtaacaatgatatctagagctttagac
ctaccaaagagagagattataaggtttgatagtaatcccatgaattattggagtttcata
cgaaatttcgaagactgttttgatgaaagagttggattccgatctaggtacaactatttg
attcagtattgtgatggtgaagctaaggctaccattgttcactgtgcattgcttgagcca
gaagaaggctatcgaaaggtgttagagcttctcgaggaagcatttggtcagaagcacatc
gtggcctatgcatttattgataagatgctgaatatccctgctattaaggggattgatcca
gatggtttaagaagactatctcgtgagatgcaggtttgtgagctcacacttacgcagatg
gactatgtatccgatcttaattatacaaagaccatcgagtgtatgttcttaaaactccca
ctgtatttacaaagagaatgggtcaaagttgcatctaggattcttaagacaggcagagag
cctttattcaaggacctttgtgaagttgtgaaggagcaatcagacattgctaatactaga
ttcatcgagtttatcgacaagggtccttggcttgtccagttttatgctccttggtgtgga
ttctgtcgccgtttggctggtacatatgaagaagccagcaggatattgcttcatacggaa
ccttcaatcaaagttgctagacttgacgccacaatatacaccgggatagccaagatgttc
gatgtgcgaggtttcccaacaattaagtatattaacggcacagtatcatatacatttact
ggtgatcgaactgttcatggtcttgttacatttgcgcaaagagctaatggaccagcagta
aagcattttgaaaaaagttatgaatttgaagaacatttaaaaaaactatcttcagacgaa
ccatttttcttcttaattaaaccagctatttctattttagagaaaacatttctacaggta
gctgaacaattacgtatattctcatggtttttcagtggttcgttatcagttattacttct
aaattcgtcaccactcgaccattgcttgcacttttaattcttggagtaccagcattaatg
ttcagtggaattgtctacttatgttgttgtttggatgcaaattatgcaacttatgatgat
ggtgaagatgaccaactttctaattatgacatttaccataaagaattatcaaatcaaaag
attattggcactgataatcccattggtgatagatcaattgtcgactcaaattcaagctat
ttggattctactagtagtagcagcagtggtagtggtatcagtgcaacaaagactattcat
ttccaagatatgcataattctcctccacgtcgacgatatcatcgtgaagttttacgtaac
agcaataaaaatattcagaatattggtcctgtttattcaaaggatgaattagagaagaga
attaaagattcacgtgcgaaattaaagaagcaagcataa

DBGET integrated database retrieval system