KEGG   Schistosoma mansoni: Smp_191310Help
Entry
Smp_191310        CDS       T01095                                 

Definition
(RefSeq) putative histone deacetylase 4, 5
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
smm  Schistosoma mansoni
Brite
Enzymes [BR:smm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Smp_191310
Chromosome [BR:smm03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     Smp_191310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
GeneDB: 
UniProt: 
Position
2
AA seq 817 aa AA seqDB search
MHTNTSTPTIHHVTESSFDSNEFNQPDATMSDLINITNNPNESNTEFNQTKQISKPFHLF
PYRRHQSIGLISRTRSAPLSLATGYSTNYRHIQLQNLNNVHNLSNSMNTPTSVTSAANIL
AMEAATTNFGNQQQTNGLNSNQSMIENDQLGVQSNNLQSSVDNELSSRSKVVLQLRKKIL
ERSEFLTSDRSGVNNLDGSNSPNSRINQTTGRINPLLERTASSPVVNMAPTIRSETVPEA
TFTTVLAYDLGMLAHHCTCQTDANHPENPQRLISIWQRLQQTGLAAKCHHQPGRRASLIE
LQLVHKDVYTVLFGSNPASRCRIDPTLLATVRLCRLACGGVGVDSDTAWHTAGHTAHAAR
LAAGCVVDLACRVMLGQCPNGFALVRPPGHHAEPGQAMGFCYFNSVAIAAKRAQFLGSTT
LGTGQSSVISSSATTLFDQSTFLPYTIESALKPRILIVDWDIHHGNGTQTVFYTDPTVLY
ISLHRHDEGGFFPGTGSPEEIGSGPGEGYTINIAWPSGIVMSDAEYLAAFRLIILPVACE
FQPSIVLISAGFDAAPGHSANLGGYSVSPAAFGWMTRLLSIDRIANSKVVLSLEGGYDMN
SLCDCTEACVRALLRSAAEINERNSIPISVPDLIPLKQSELDRVPHPSAIQTLLKVAHLH
SVYWTSFSNEIGTQYASMPASSWLPTIFDNSSIEIKDLSSTTEHISVVSTNVTPLSANKR
FLKSLIKQTPLTTDLNVLTSGNVTENNRYYNFVMRQASSMDETNETEMKPNSIRRRSTTG
ITPSNMDSITSINDTNETITRIALTRLAELHVTSQPE
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaaatacttcaacaccgacgatacatcatgtaactgaatcaagtttcgactca
aatgaattcaatcaacccgatgcaacaatgtctgatctaatcaatattactaataatcct
aatgaatccaatacagaattcaatcaaactaaacaaatcagtaaaccatttcatctattt
ccatatcgtcgacatcaatcaattggattaattagtcgtactagatcagctccattaagt
ttagctactggttattcaacaaattatcgacatatacaattacaaaatttgaataatgta
cataatctatccaattcaatgaatacaccaacatctgttacttccgcagcaaatatttta
gctatggaagcagctacaacgaattttggtaatcaacaacaaacgaatggattgaattca
aatcaatccatgatagagaatgatcaattaggagtacaaagtaacaatttacaatcatct
gtagataatgaattatcttcacgaagtaaagttgttttacagttacgtaagaagatttta
gaaagatctgaatttttaacatcagatcgttcaggtgtaaacaatttggatggttctaat
tcaccaaattctcgaattaatcaaacaactggacgtattaatccattattagaaagaaca
gcttcaagtcctgtagtgaatatggctccaacaatacgatcagaaactgtacctgaagca
acattcactacagtattagcatatgatttgggaatgcttgctcatcattgtacatgtcaa
accgatgcaaatcatcctgaaaatcctcaacgattaatttctatttggcaaagacttcaa
caaactggtttggcagcaaaatgtcatcatcaacctggcagacgagcatctttaattgaa
ctgcaattagttcacaaagatgtgtatacagttttatttggcagtaatccagcaagtaga
tgtcggattgatccaacccttttagctacagtacgtttatgtaggctagcctgtggcgga
gtcggtgtagattctgatacagcttggcacactgctggacatacagctcatgcagcgaga
ctggcagctggatgtgttgttgatttggcatgtcgtgtaatgcttggtcaatgtcccaat
ggttttgctttagtaagaccacctggacaccatgcagaaccaggtcaagctatgggattt
tgttatttcaactcagtggcgatagctgctaaacgagctcaattccttggttcaacaaca
ctaggtactggacaaagctctgtaatttcttcttcagcaaccaccctgttcgatcaatca
acttttctcccatacactatagaatccgcacttaaaccacgaattttaatagtagactgg
gatattcatcatggaaacggaactcaaacagtattttacacagacccaactgtgttgtac
atatcacttcatagacatgatgaaggaggattttttcccggtactggatcacctgaagaa
ataggctctggtcctggagaaggatataccattaatattgcttggccatcaggaatagtt
atgtctgatgctgagtatttagcagcatttcgtttgattattctacccgtcgcttgtgaa
tttcaacctagtattgttttaatttccgctggtttcgacgctgctcccggtcattcagct
aatctcggtggttattcagtaagtcctgctgcttttggttggatgacacgtctattatca
attgatcgtattgctaattccaaagtagtattatccctagaaggtggttatgatatgaat
agtctttgtgattgtacagaagcttgtgtacgagcattacttagatcagctgctgaaata
aatgaaagaaattcaatacctatcagtgttccagatttaattcctttaaaacaatctgaa
ttagatagagttccacatccttcagcaatacaaactttattaaaagttgcacatttacat
tctgtttattggactagtttctctaatgaaattggtacacaatatgcatctatgcctgct
agtagttggttaccaacaatatttgataatagttcaattgaaatcaaagatttgagttca
actactgagcatatttcagtagtatctacaaatgttacaccattaagtgctaataaaaga
ttcttaaaatctttaattaaacaaacaccgttaactactgacttgaatgtacttacatct
gggaatgtgacagaaaataatcgatattacaatttcgtcatgcgacaagcttcatcaatg
gatgaaactaatgaaactgaaatgaaaccaaattctataagaagaagatcaacaactggt
attacaccttctaatatggattccataacatcaataaatgatacaaatgaaacaataaca
cgtattgcattaacacgtctagctgaattacatgtcacttcacaacctgaatga

DBGET integrated database retrieval system