KEGG   Schistosoma mansoni: Smp_191310Help
Entry
Smp_191310        CDS       T01095                                 

Definition
histone deacetylase 4 5
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
smm  Schistosoma mansoni
Brite
Enzymes [BR:smm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Smp_191310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 291 aa AA seqDB search
QTGLAAKCHHQPGRRASLIELQLVHKDVYTVLFGSNPASRCRIDPTLLATVRLCRLACGG
VGVDSDTAWHTAGHTAHAARLAAGCVVDLACRVMLGQCPNGFALVRPPGHHAEPGQAMGF
CYFNSVAIAAKRAQFLGSTTLESALKPRILIVDWDIHHGNGTQTVFYTDPTVLYISLHRH
DEGGFFPGTGSPEEIGSGPGEGYTINIAWPSGIVMSDAEYLAAFRLIILPVACEFQPSIV
LISAGFDAAPGHSANLGGYSVSPAAFGWMTRLLSIDRIANSKVVLSPRRWL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
caaactggtttggcagcaaaatgtcatcatcaacctggcagacgagcatctttaattgaa
ctgcaattagttcacaaagatgtgtatacagttttatttggcagtaatccagcaagtaga
tgtcggattgatccaacccttttagctacagtacgtttatgtaggctagcctgtggcgga
gttggtgtagattctgatacagcttggcacactgctggacatacagctcatgcagcgaga
ctggcagctggatgtgttgttgatttggcatgtcgtgtaatgcttggtcaatgtcccaat
ggttttgctttagtaagaccacctggacaccatgcagaaccaggtcaagctatgggattt
tgttatttcaactcagtggcgatagctgctaaacgagctcaattccttggttcaacaaca
ctagaatccgcacttaaaccacgaattttaatagtagactgggatattcatcatggaaac
ggaactcaaacagtattttacacagacccaactgtgttgtacatatcacttcatagacat
gatgaaggaggattttttcccggtactggatcacctgaagaaataggctctggtcctgga
gaaggatataccattaatattgcttggccatcaggaatagttatgtctgatgctgagtat
ttagcagcatttcgtttgattattctacccgtcgcttgtgaatttcaacctagtattgtt
ttaatttccgctggtttcgacgctgctcccggtcattcagctaatctcggtggttattca
gtaagtcctgctgcttttggttggatgacacgtctattatcaattgatcgtattgctaat
tccaaagtagtattatcccctagaaggtggttatga

DBGET integrated database retrieval system