KEGG   Schistosoma mansoni: Smp_191310Help
Entry
Smp_191310        CDS       T01095                                 

Definition
histone deacetylase 4 5
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
smm  Schistosoma mansoni
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 291 aa AA seqDB search
QTGLAAKCHHQPGRRASLIELQLVHKDVYTVLFGSNPASRCRIDPTLLATVRLCRLACGG
VGVDSDTAWHTAGHTAHAARLAAGCVVDLACRVMLGQCPNGFALVRPPGHHAEPGQAMGF
CYFNSVAIAAKRAQFLGSTTLESALKPRILIVDWDIHHGNGTQTVFYTDPTVLYISLHRH
DEGGFFPGTGSPEEIGSGPGEGYTINIAWPSGIVMSDAEYLAAFRLIILPVACEFQPSIV
LISAGFDAAPGHSANLGGYSVSPAAFGWMTRLLSIDRIANSKVVLSPRRWL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
caaactggtttggcagcaaaatgtcatcatcaacctggcagacgagcatctttaattgaa
ctgcaattagttcacaaagatgtgtatacagttttatttggcagtaatccagcaagtaga
tgtcggattgatccaacccttttagctacagtacgtttatgtaggctagcctgtggcgga
gttggtgtagattctgatacagcttggcacactgctggacatacagctcatgcagcgaga
ctggcagctggatgtgttgttgatttggcatgtcgtgtaatgcttggtcaatgtcccaat
ggttttgctttagtaagaccacctggacaccatgcagaaccaggtcaagctatgggattt
tgttatttcaactcagtggcgatagctgctaaacgagctcaattccttggttcaacaaca
ctagaatccgcacttaaaccacgaattttaatagtagactgggatattcatcatggaaac
ggaactcaaacagtattttacacagacccaactgtgttgtacatatcacttcatagacat
gatgaaggaggattttttcccggtactggatcacctgaagaaataggctctggtcctgga
gaaggatataccattaatattgcttggccatcaggaatagttatgtctgatgctgagtat
ttagcagcatttcgtttgattattctacccgtcgcttgtgaatttcaacctagtattgtt
ttaatttccgctggtttcgacgctgctcccggtcattcagctaatctcggtggttattca
gtaagtcctgctgcttttggttggatgacacgtctattatcaattgatcgtattgctaat
tccaaagtagtattatcccctagaaggtggttatga

DBGET integrated database retrieval system