KEGG   Schistosoma mansoni: Smp_194460Help
Entry
Smp_194460        CDS       T01095                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smm  Schistosoma mansoni
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:smm01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:smm00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:smm00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:smm00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 246 aa AA seqDB search
HHGKPGDTGRXXXXVYIRYVIAKRLTESKRTIPHYYLTMDIQVDEILEIRSKINSSLSNL
NDSKSVEPVPKISLNDILIKAASLTCLKVPECNSSWHGDFIRQYHTVDVSVAVAIPSGLI
TPIIFSADTKGLVQINKEMRMLVTKAKQNKLKPQEYQGGTFSISNLGMFGITNFCAIINP
PQACILTVGSTRPKLLPDHKNPKGFKEANILSVTLCCDHRVVDGAVGAHWLSEFKQILEN
PALFLI
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
caccatggaaaacctggagacactggacggnnnnnnnnnngagtctacatcagatatgtg
attgctaaacgattgactgaatcaaaacgaactattccacattattatttaacaatggat
attcaagtggatgaaattctagaaatacgttctaaaatcaattcaagtttatccaattta
aacgattcaaaatctgttgaacctgtgccaaaaataagtttaaatgatattcttataaaa
gcagcttcattaacatgtttaaaagtacctgagtgtaattcatcttggcatggtgatttt
atccgacaataccatactgtcgatgtaagtgtagctgtggctattccttctggattaatc
acaccaataatattttctgcagatacaaagggtttagtacaaatcaataaagaaatgcga
atgttagttactaaggctaaacagaataaactaaaacctcaagaatatcagggtggaaca
ttttcaatttctaatttgggaatgtttggaattaccaatttctgtgctatcattaatcca
cctcaagcatgtatccttaccgtgggtagtaccagaccgaaacttttaccagatcataaa
aatcctaaaggatttaaagaagcaaatattttatcagttacattatgctgtgatcatcgt
gttgttgatggagcagttggagctcattggcttagtgaatttaaacaaattttagagaat
ccagcactttttcttatttaa

DBGET integrated database retrieval system