KEGG   Schistosoma mansoni: Smp_194460Help
Entry
Smp_194460        CDS       T01095                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smm  Schistosoma mansoni
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smp_194460
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smp_194460
   00020 Citrate cycle (TCA cycle)
    Smp_194460
   00620 Pyruvate metabolism
    Smp_194460
Enzymes [BR:smm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Smp_194460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 246 aa AA seqDB search
HHGKPGDTGRXXXXVYIRYVIAKRLTESKRTIPHYYLTMDIQVDEILEIRSKINSSLSNL
NDSKSVEPVPKISLNDILIKAASLTCLKVPECNSSWHGDFIRQYHTVDVSVAVAIPSGLI
TPIIFSADTKGLVQINKEMRMLVTKAKQNKLKPQEYQGGTFSISNLGMFGITNFCAIINP
PQACILTVGSTRPKLLPDHKNPKGFKEANILSVTLCCDHRVVDGAVGAHWLSEFKQILEN
PALFLI
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
caccatggaaaacctggagacactggacggnnnnnnnnnngagtctacatcagatatgtg
attgctaaacgattgactgaatcaaaacgaactattccacattattatttaacaatggat
attcaagtggatgaaattctagaaatacgttctaaaatcaattcaagtttatccaattta
aacgattcaaaatctgttgaacctgtgccaaaaataagtttaaatgatattcttataaaa
gcagcttcattaacatgtttaaaagtacctgagtgtaattcatcttggcatggtgatttt
atccgacaataccatactgtcgatgtaagtgtagctgtggctattccttctggattaatc
acaccaataatattttctgcagatacaaagggtttagtacaaatcaataaagaaatgcga
atgttagttactaaggctaaacagaataaactaaaacctcaagaatatcagggtggaaca
ttttcaatttctaatttgggaatgtttggaattaccaatttctgtgctatcattaatcca
cctcaagcatgtatccttaccgtgggtagtaccagaccgaaacttttaccagatcataaa
aatcctaaaggatttaaagaagcaaatattttatcagttacattatgctgtgatcatcgt
gttgttgatggagcagttggagctcattggcttagtgaatttaaacaaattttagagaat
ccagcactttttcttatttaa

DBGET integrated database retrieval system