KEGG   Schistosoma mansoni: Smp_194520Help
Entry
Smp_194520        CDS       T01095                                 

Definition
myst histone acetyltransferase
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
smm  Schistosoma mansoni
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 496 aa AA seqDB search
MSCLIYFFTSVHRITDEDLLHTTGSDNTSFEVSNSANPDDGQKKVSDGGKKKMVHNPTDD
TDVKGSTLDPDIQIGEVYKVLRSSGQYYPAAVIEGRIDGNGNKEYYVHYCNHDRRLDEWV
TSERIDCSEKLTISCELSLNQLTDYAGHDVRLTRNQKRKLEETSKVLQESDSLDSTTQKL
ELEYQEFTRVKFIDQIQFGKYEIDTWYFSPYPEEFRQVKKLWICEYCLKYMKHSETWLNH
IKYDCEAKRPPGKEIYNHENLCVFELDGNVQKLYCQNLCLLAKLFLDHKTLYYNVSPFIF
YVLCEIDNDGVHLVGYFSKEKVSADNYNLACILTLPPFQRRGYGHFLISLSYELAKIEQI
VGTPEKPLSDLGRLSYRSYWEKVILNFLFENPNCTMNELSTKTCIAIDDIIWTLQYHPVI
NNWQHGHQICLHRDTIQQYLNQLNNEHSTKAFPTDSKEQRKNRKLMHKHSFVLDINRLKW
DPPVKSPQNNKEVKCN
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgtcttatatatttttttacatctgtccatcggattacagatgaagatctgcta
catacgacaggatcagacaacaccagtttcgaagtttctaacagcgccaatcctgatgat
ggacaaaaaaaagtcagtgacggaggtaaaaaaaagatggttcataatccgaccgatgat
acggatgtaaaagggtctacacttgatccagatatacaaattggagaagtctataaagtt
ttacgatcttctggtcaatactatcctgctgccgtaattgaaggtcgtatagatggtaac
gggaataaggaatattatgttcattattgcaatcacgaccgtagattagatgaatgggtt
acatctgaacgaattgactgttccgaaaagcttacaatttcatgcgagttgtctcttaac
cagttaacggattatgctgggcatgatgtccgactaaccagaaatcagaaacgcaagtta
gaagaaacttccaaagttcttcaagaaagtgactctttagactctactacgcagaaattg
gagcttgaatatcaagaattcactcgagtaaaatttattgatcagatacaatttggcaag
tacgaaattgacacatggtatttttcaccttatccggaagaatttagacaggtgaagaag
ttatggatatgtgaatattgtttaaaatatatgaagcattcagaaacatggttaaatcat
ataaaatatgattgtgaagcaaaacgacctcctggtaaagaaatatacaatcatgaaaat
ctatgcgtctttgaattagatggcaatgtacaaaagctatactgtcaaaatctatgtctg
ctggccaaattgtttttagatcataagacattatattataatgtctcaccgtttatattc
tatgttctatgtgagatagacaatgatggagtacatcttgttggttatttttccaaggaa
aaagtatctgctgataattataatcttgcatgtatcttaactttaccaccatttcaacgt
cgtggatatggtcatttcttaattagtctcagttatgaattagctaaaattgaacaaatt
gttggtacaccagaaaaacctctctccgatttaggtcgtttaagttatcgtagttattgg
gaaaaggtgatattgaattttctattcgaaaatcctaattgtacaatgaatgaattaagt
acaaaaacatgtattgcaattgatgatattatttggacattacaatatcatccagttatt
aataattggcaacatggtcatcagatatgcctacatcgtgatactatacaacaatatttg
aatcaattaaataatgaacattctacgaaagcctttcctacagatagtaaagaacaacgg
aaaaatcgtaaattaatgcataaacattcttttgtactggatattaatcgattaaaatgg
gatccaccagttaaatcaccacagaataataaagaagtcaagtgtaactaa

DBGET integrated database retrieval system