KEGG   Schistosoma mansoni: Smp_194610Help
Entry
Smp_194610        CDS       T01095                                 

Definition
serine/threonine protein kinase
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
smm  Schistosoma mansoni
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:smm00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Smp_194610
   04340 Hedgehog signaling pathway
    Smp_194610
Enzymes [BR:smm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Smp_194610
Protein kinases [BR:smm01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   Smp_194610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 361 aa AA seqDB search
MMHFMASRVRRMLFLYKKNKNNQSNQDSKTNQYVKVIPFDKKKFDLRKVELLRTIGTGTF
GRVIVVHDKCSQQYYALKVLVIEELVRLKQVEHVKNEKSILMQLNHPFIVKLYWTGHDAK
FLYMLFEYVCGGELFKYLREVGHFSSETTRFYASEIILALKYLHSLNIVYRDLKPENLLL
DYSGHLKMTDFGFAKHVKDRTYSLCGTPEYLAPEILQGKGHNHAADWWTTGIIIYEMLVG
RPPFYDENDNRLHIYQKIVSGDFDFPDEIVDENAKSIVRKFLRVNLNERLGSSKDSMYEI
LEHPWFSDICWSDVFQRKLKPPIIPNVQSDGDTCCYEQYFEQDWSEIPLSSVSSRNLFKE
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgatgcactttatggcgtccagagttcgaagaatgctttttttatataaaaagaacaaa
aacaaccaaagtaatcaagattccaaaacaaatcagtatgttaaagttattccgtttgat
aaaaagaagttcgacttgaggaaagttgaactattacgtaccatcggaacaggaacgttt
ggtcgtgtaattgtagttcatgataaatgctcacaacaatactatgcattgaaagtattg
gttatagaagaattggtacgattgaaacaagtagaacatgtcaaaaacgaaaagtcaata
ctaatgcaattaaaccatccttttattgtaaagctatattggactggacacgacgcgaaa
tttttatacatgttatttgaatatgtatgtggtggtgaactgttcaaatatcttcgagaa
gtgggccatttctcatccgaaactacacgattttatgcgagtgaaattattttggcactg
aaatatttacacagtttgaatatcgtgtatagagatttaaaaccggaaaatttacttttg
gattattcaggtcatttgaagatgactgattttggattcgcaaagcatgttaaagaccgg
acttattctctttgtggtacacctgaatacttggcacctgaaattctgcagggtaaaggt
cacaatcatgcagctgattggtggaccacaggaattattatttatgaaatgttggttggt
cgtccaccattttatgatgaaaacgataatcggttgcatatatatcagaaaattgtatca
ggagattttgacttcccagacgaaatagtagatgaaaatgctaaatcaatcgtcagaaaa
tttctacgtgtgaatctcaatgaacgacttggcagttctaaagatagtatgtatgaaata
ttagaacatccgtggttcagtgatatttgttggagtgatgttttccagagaaagttaaag
ccccccatcattcccaatgtacagagtgatggtgatacctgctgttatgaacagtatttt
gaacaagattggtctgaaattcccttatccagtgttagttctcgtaatttattcaaagaa
ttttaa

DBGET integrated database retrieval system