KEGG   Schistosoma mansoni: Smp_194610Help
Entry
Smp_194610        CDS       T01095                                 

Definition
serine/threonine protein kinase
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
smm  Schistosoma mansoni
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:smm04310]
Environmental Information Processing; Signal transduction; Hedgehog signaling pathway [PATH:smm04340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 361 aa AA seqDB search
MMHFMASRVRRMLFLYKKNKNNQSNQDSKTNQYVKVIPFDKKKFDLRKVELLRTIGTGTF
GRVIVVHDKCSQQYYALKVLVIEELVRLKQVEHVKNEKSILMQLNHPFIVKLYWTGHDAK
FLYMLFEYVCGGELFKYLREVGHFSSETTRFYASEIILALKYLHSLNIVYRDLKPENLLL
DYSGHLKMTDFGFAKHVKDRTYSLCGTPEYLAPEILQGKGHNHAADWWTTGIIIYEMLVG
RPPFYDENDNRLHIYQKIVSGDFDFPDEIVDENAKSIVRKFLRVNLNERLGSSKDSMYEI
LEHPWFSDICWSDVFQRKLKPPIIPNVQSDGDTCCYEQYFEQDWSEIPLSSVSSRNLFKE
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgatgcactttatggcgtccagagttcgaagaatgctttttttatataaaaagaacaaa
aacaaccaaagtaatcaagattccaaaacaaatcagtatgttaaagttattccgtttgat
aaaaagaagttcgacttgaggaaagttgaactattacgtaccatcggaacaggaacgttt
ggtcgtgtaattgtagttcatgataaatgctcacaacaatactatgcattgaaagtattg
gttatagaagaattggtacgattgaaacaagtagaacatgtcaaaaacgaaaagtcaata
ctaatgcaattaaaccatccttttattgtaaagctatattggactggacacgacgcgaaa
tttttatacatgttatttgaatatgtatgtggtggtgaactgttcaaatatcttcgagaa
gtgggccatttctcatccgaaactacacgattttatgcgagtgaaattattttggcactg
aaatatttacacagtttgaatatcgtgtatagagatttaaaaccggaaaatttacttttg
gattattcaggtcatttgaagatgactgattttggattcgcaaagcatgttaaagaccgg
acttattctctttgtggtacacctgaatacttggcacctgaaattctgcagggtaaaggt
cacaatcatgcagctgattggtggaccacaggaattattatttatgaaatgttggttggt
cgtccaccattttatgatgaaaacgataatcggttgcatatatatcagaaaattgtatca
ggagattttgacttcccagacgaaatagtagatgaaaatgctaaatcaatcgtcagaaaa
tttctacgtgtgaatctcaatgaacgacttggcagttctaaagatagtatgtatgaaata
ttagaacatccgtggttcagtgatatttgttggagtgatgttttccagagaaagttaaag
ccccccatcattcccaatgtacagagtgatggtgatacctgctgttatgaacagtatttt
gaacaagattggtctgaaattcccttatccagtgttagttctcgtaatttattcaaagaa
ttttaa

DBGET integrated database retrieval system