KEGG   Streptococcus macedonicus: SMA_0041Help
Entry
SMA_0041          CDS       T01674                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
smn  Streptococcus macedonicus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:smn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SMA_0041 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMA_0041 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SMA_0041 (thrC)
Enzymes [BR:smn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SMA_0041 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
48017..49501
Genome map
AA seq 494 aa AA seqDB search
MTLIYQSTRDENNKVTASQAILQGLATDGGLFTPVSLPEVALDFETLKDASYQEVAKLVL
SAFLDDFTEEELAYCIDSAYDAKFDTPEIAPLVKLGDQYNLELFHGSTIAFKDMALSILP
YLLTTSAKKQGVDNKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPKDGVSKIQELQMT
TQTGNNTHVVAITGNFDDAQTDVKRMFNDVDLREKLLAHKTQFSSANSMNVGRLVPQVVY
YVYAYAQLVKTGHIKAGDKVNFTVPTGNFGNILAAYYASQIGVPVGKLICASNENKVLTD
FFTTGTYDKKREFKITTSPSMDILVSSNLERLIFHLLGNDAAKTKALMEQLVSGGEYTLP
DVDQSILDLFEAGYATEVETSAEIKRVYEASDYIEDPHTAVASAVYQKYAERTGDKTPTV
IASTASPYKFPRVAVEAVSGQAPADDFVAVKELEKSSGVAIPKAVNELETAEVRHKTVVA
TGDMQKAVENYLGL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacgttaatttaccaatcaactcgtgatgaaaataacaaagtaactgctagtcaagct
atcttacaaggattggcaactgacggtggtttatttacccctgtatcacttccagaagtg
gcattggattttgaaactttaaaagatgcttcttaccaagaagtggctaagcttgtattg
tctgcatttttagacgatttcacagaagaagagttggcttactgtattgattctgcttac
gatgctaaatttgatacaccagaaatcgcaccgctggttaaattaggtgaccaatataac
cttgaacttttccatgggtcaactattgcgtttaaagacatggcattgtcaatcttgcca
taccttttgacaacatcagctaaaaaacaaggcgttgataacaaaattgtgattttgaca
gcgacatcaggtgatactggtaaagctgcaatggctggttttgcagatgtcccaggaaca
gaaatcattgttttctatccaaaagacggtgtcagcaaaattcaagagcttcagatgaca
acacaaactggtaataacacacacgttgtagccattactggtaactttgatgatgcgcaa
acagatgtaaaacgtatgtttaacgacgttgatttgcgtgaaaaattgcttgcgcacaag
acacaattttcatcagcgaactcaatgaatgttgggcgtttggtaccacaggttgtttat
tatgtttatgcttatgcacaacttgttaaaactggtcatattaaagcaggcgacaaagta
aactttacagttccaacaggaaattttggaaacattctagcagcttactacgcaagtcaa
atcggtgtcccagttggtaaattaatctgtgcttcaaatgaaaacaaagttttaacagac
ttcttcacaacagggacttatgataaaaaacgtgagtttaaaattacaacaagtccttca
atggatatcttggtatcatctaacttagaacgtttgattttccatttgttgggaaatgat
gctgctaagacgaaagcattgatggaacaattggtttcagggggtgaatacacacttcct
gatgttgaccaatcgattcttgatttatttgaagcaggctatgcaacagaagttgaaacg
tctgctgaaattaaacgtgtctatgaagcatctgattacattgaggacccacatacggca
gttgcatcagctgtttatcaaaaatacgcagagcgtacaggtgataaaacaccaactgtg
attgcttcaacagcaagtccatataaattcccacgtgtggcagttgaagctgttagtgga
caagcaccagcagatgattttgttgctgttaaggaacttgaaaaatcatcaggtgttgcc
attccaaaagctgtcaatgaacttgaaacagctgaggttcgtcacaaaacggttgtggca
acaggtgatatgcaaaaagcagttgaaaattatttaggactttaa

DBGET integrated database retrieval system