KEGG   Streptococcus macedonicus: SMA_0220Help
Entry
SMA_0220          CDS       T01674                                 

Gene name
gtfA
Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
smn  Streptococcus macedonicus
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:smn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SMA_0220 (gtfA)
Enzymes [BR:smn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     SMA_0220 (gtfA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
218839..220284
Genome map
AA seq 481 aa AA seqDB search
MTIQNKTMLITYSDSLGKNLKELNENLGKYFGEAVGGVHLLPFFPSTGDRGFAPVDYDEV
DAAFGDWDDVKALGEKYYLMFDFMINHISRQSKYYKDYQEKHEASAYKDMFLNWDKFWPE
NRPTQADVDLIYKRKDRAPKQEIHFADGSVEHLWNTFGEEQIDLDVTKDVTMDFIRKTIA
HLAENGCDLIRLDAFAYAVKKLDTNDFFVEPEIWELLDKVRSIAAESGTELLPEIHEHYS
IQFKIAEHDYYVYDFALPMVVLYSLYSGNVNRLAKWLKMSPMKQFTTLDTHDGIGVVDVK
DILTDEEIDYTSNELYKVGANVNRKYSTAEYNNLDIYQINSTYYSALGDDDKKYFLARLI
QAFAPGIPQVYYVGFLAGKNDLELLEKTKEGRNINRHYYSSSEIAEEVKRPVVQALLKLF
TFRNQSAAFDLDGSIEVDELDSHTILITRRNQGSSVVAQAKINLKDLTYHITENGQEITF
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgacaatacaaaataaaacaatgcttattacttactcagatagtctgggaaagaatttg
aaagaattaaatgaaaatcttggcaagtattttggagaagctgttggcggggttcatctt
ttgccatttttcccgtcaacaggtgaccgtggttttgcgccagtcgattatgatgaggtt
gatgctgcatttggggattgggatgacgtgaaggcattgggtgagaagtattatctcatg
tttgatttcatgattaaccatatttctcgtcaatcaaaatattacaaagattatcaagaa
aagcacgaagctagtgcttacaaggatatgtttcttaactgggataaattttggccagaa
aatcgtccgacacaagctgatgtggatttgatttacaagcgtaaagaccgcgcaccaaaa
caagaaattcactttgcggacggttcagttgagcatctctggaacacatttggtgaagag
cagattgaccttgatgtgacaaaagacgtgaccatggatttcattcgaaagaccatcgcg
catttagctgaaaatggttgcgaccttattcgattagatgcttttgcttatgcagttaaa
aaattagatactaatgatttctttgtagaaccagaaatctgggaattgcttgataaagtc
cgtagcattgctgcggaatctggtacagagttacttccagaaattcacgagcattattcg
attcagtttaaaatcgctgagcacgattactatgtttatgattttgcccttccgatggtg
gttctttatagcctttacagcggaaatgttaatcgtttggcgaaatggcttaaaatgtct
ccaatgaaacaatttacgacacttgatacgcacgatggtattggagttgttgatgtcaaa
gatatcttgacggatgaggaaattgattacacgtcaaatgaactttataaagtaggtgcc
aacgtcaaccgaaaatattcaacagccgagtataataatcttgatatctaccaaatcaat
tcaacttactattctgcgcttggggatgatgacaagaaatatttcttagctcgtttgatt
caagctttcgcgccaggcattccacaagtgtattatgttggctttttagctggtaaaaat
gatcttgaattgttagaaaaaacaaaagaagggcgcaatattaatcgtcattattatagc
agtagcgaaattgcagaagaagtcaaacgtccagttgttcaagctttgctaaaattattt
actttccgtaatcaatcggctgcttttgacctggatggcagtattgaagttgatgaactt
gatagtcacacaattcttattacacgccgtaatcaaggcagtagtgttgtcgcacaagca
aagattaatctaaaagatttgacttatcatatcacagaaaacggtcaagaaattaccttt
ctataa

DBGET integrated database retrieval system