KEGG   Streptococcus macedonicus: SMA_0243Help
Entry
SMA_0243          CDS       T01674                                 

Gene name
adhE
Definition
alcohol dehydrogenase; Acetaldehyde dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
smn  Streptococcus macedonicus
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SMA_0243 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMA_0243 (adhE)
   00620 Pyruvate metabolism
    SMA_0243 (adhE)
   00650 Butanoate metabolism
    SMA_0243 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    SMA_0243 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SMA_0243 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SMA_0243 (adhE)
   00626 Naphthalene degradation
    SMA_0243 (adhE)
Enzymes [BR:smn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SMA_0243 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SMA_0243 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
245112..247157
Genome map
AA seq 681 aa AA seqDB search
MVNAALKSGNPSMGVGAGNGAIYVDATAHIDRAVEDLLLSKRFDNGMICATENSAVVEAS
VYKEWLQKMQDKGAYLVPKKDYNKIEDFVFNDNHGVNGPVAGMPATWICEQAGVKLPEGK
DVLLFELDKKNIGEKLTSEKLSPLLSVYKAKDRQEGIEIVEALLDYQGAGHNAGIQIGSQ
ADPFVATYGDAVKASRVLVNQPDSVGGIGDIYTDALKASLTIGTGSWGKNSLSHNLSTGD
LLNIKTVAKRRNRPQWIRLPGKTYYEKNAISYLQDEYEPMQRALIIADPGMVQFGFVDTV
LAQLALRDEKVATSIYETIKPDPTLGQTIEIAKQMRDFKPDTVIAIGGGSAIDASKIARL
IYEFYLDRGDEFLDSYDAVSEFFLELQQKIIYIRKRIVKFKHQTTIRLFCIPTTSGTGAE
VTPFAVITDDYTHVKYPLADYELVPQVAIVDPEFVMTVPKRTAAWSGLDALSHALESYVS
VMASDFTRPWSLEAIKLIIENLEDAYNYDPKNPTLRGEKAKENMHYAAVIAGMAFGNAFL
GINHSLAHKTGGEFGLPHGLAISIAMQHVIRYNGASGNVKRSVYPRYEEYRAQKDYADIA
HYIGLKGKDDAELVEALCDRIDKLIHTVDVEPKLSANGITKEAFDAAANRLASLAYDDQC
TPINPRQPYISELKQLLIDMF
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggtaaatgcagcccttaaatcaggtaacccatcaatgggtgtcggtgcaggtaatggt
gctatctatgttgatgcaactgctcatattgaccgcgctgtggaagacttgttgttatca
aaacgctttgataatggtatgatttgtgcgactgaaaattcagcagtcgttgaagcgtca
gtttacaaagaatggttgcaaaaaatgcaagataaaggtgcttacttagtacctaagaag
gactacaataaaattgaagactttgttttcaatgataaccatggtgtaaacggtcctgtt
gccgggatgccagcaacttggatttgtgaacaagctggtgtgaaattgccagaaggtaaa
gatgttctcttgtttgagcttgacaagaaaaacatcggtgaaaaactaacatcagaaaaa
ttgtctccactcctttcagtgtacaaagctaaagatcgtcaagaaggtatcgaaattgtt
gaagcacttcttgattatcaaggtgcagggcacaatgccggtatccaaattggttcacaa
gcagacccatttgtagcaacatatggcgatgccgtgaaagcatcacgtgtcttggttaac
caaccagattcagtcggaggtatcggtgatatctatacagacgcacttaaagccagctta
acaattggaacaggatcatgggggaaaaattcattgtcacacaatctttcaactggcgat
ctcttaaatatcaagactgttgcgaaacgtcgtaaccgtccacaatggattcgcttgcca
ggaaaaacttactacgaaaagaatgctatctcatatttgcaagatgaatatgaaccaatg
caacgtgctttgattatagcagacccaggtatggttcaatttggatttgttgacactgtc
cttgctcaattggcattgcgtgatgaaaaagtcgcaacatcaatttacgaaacaatcaaa
ccagacccaacccttggacaaacaatcgaaattgcaaaacaaatgcgtgatttcaaacca
gatacagtcattgcaattggtggtggctctgctattgatgcatctaagattgcacgttta
atttatgaattttatcttgaccgtggtgatgaattccttgatagttatgatgctgttagc
gaatttttccttgaattgcaacaaaaaatcatttatattcgtaaacgtattgtgaaattc
aaacatcaaacaacaatacgtctcttctgtatcccaaccacatctggtacaggtgctgag
gtgacaccatttgcggttattactgatgattatacacacgtgaaatacccacttgctgat
tatgaattggtaccacaagttgctattgttgatccagaatttgttatgactgtgccaaaa
cgtacagcagcttggtcaggattagatgctttgtcacatgctcttgaatcttacgtatca
gttatggcatctgactttacacgtccatggtctcttgaagctatcaagttgattattgaa
aatcttgaagatgcttataactacgatcctaagaacccaacacttcgtggtgaaaaagct
aaagaaaatatgcattatgcagcagttattgctggtatggcatttggtaatgctttctta
ggtatcaaccattcacttgctcacaaaacaggtggtgaatttggacttccacacggttta
gctatttcaatcgcaatgcaacatgttatccgctataacggtgcatctggtaatgttaaa
cgctcagtttatccacgttatgaagaataccgtgctcaaaaagattacgcagatattgcg
cattatattggtcttaaaggtaaagatgatgcagaattagtcgaagcactttgcgaccgc
attgataaattgattcatactgttgacgttgaaccaaaactttctgctaatgggatcaca
aaagaagcctttgatgcagcagctaatcgtttggcaagcttggcatatgatgaccaatgt
actccaataaacccacgtcaaccatacatttcagaattgaaacaacttttgattgatatg
ttctaa

DBGET integrated database retrieval system