KEGG   Streptococcus macedonicus: SMA_0243Help
Entry
SMA_0243          CDS       T01674                                 

Gene name
adhE
Definition
alcohol dehydrogenase; Acetaldehyde dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
smn  Streptococcus macedonicus
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:smn01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:smn00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:smn00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:smn00650]
Metabolism; Lipid metabolism; Fatty acid degradation
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:smn00350]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:smn00362]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:smn00625]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:smn00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:smn00621]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:smn00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
245112..247157
Genome map
AA seq 681 aa AA seqDB search
MVNAALKSGNPSMGVGAGNGAIYVDATAHIDRAVEDLLLSKRFDNGMICATENSAVVEAS
VYKEWLQKMQDKGAYLVPKKDYNKIEDFVFNDNHGVNGPVAGMPATWICEQAGVKLPEGK
DVLLFELDKKNIGEKLTSEKLSPLLSVYKAKDRQEGIEIVEALLDYQGAGHNAGIQIGSQ
ADPFVATYGDAVKASRVLVNQPDSVGGIGDIYTDALKASLTIGTGSWGKNSLSHNLSTGD
LLNIKTVAKRRNRPQWIRLPGKTYYEKNAISYLQDEYEPMQRALIIADPGMVQFGFVDTV
LAQLALRDEKVATSIYETIKPDPTLGQTIEIAKQMRDFKPDTVIAIGGGSAIDASKIARL
IYEFYLDRGDEFLDSYDAVSEFFLELQQKIIYIRKRIVKFKHQTTIRLFCIPTTSGTGAE
VTPFAVITDDYTHVKYPLADYELVPQVAIVDPEFVMTVPKRTAAWSGLDALSHALESYVS
VMASDFTRPWSLEAIKLIIENLEDAYNYDPKNPTLRGEKAKENMHYAAVIAGMAFGNAFL
GINHSLAHKTGGEFGLPHGLAISIAMQHVIRYNGASGNVKRSVYPRYEEYRAQKDYADIA
HYIGLKGKDDAELVEALCDRIDKLIHTVDVEPKLSANGITKEAFDAAANRLASLAYDDQC
TPINPRQPYISELKQLLIDMF
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggtaaatgcagcccttaaatcaggtaacccatcaatgggtgtcggtgcaggtaatggt
gctatctatgttgatgcaactgctcatattgaccgcgctgtggaagacttgttgttatca
aaacgctttgataatggtatgatttgtgcgactgaaaattcagcagtcgttgaagcgtca
gtttacaaagaatggttgcaaaaaatgcaagataaaggtgcttacttagtacctaagaag
gactacaataaaattgaagactttgttttcaatgataaccatggtgtaaacggtcctgtt
gccgggatgccagcaacttggatttgtgaacaagctggtgtgaaattgccagaaggtaaa
gatgttctcttgtttgagcttgacaagaaaaacatcggtgaaaaactaacatcagaaaaa
ttgtctccactcctttcagtgtacaaagctaaagatcgtcaagaaggtatcgaaattgtt
gaagcacttcttgattatcaaggtgcagggcacaatgccggtatccaaattggttcacaa
gcagacccatttgtagcaacatatggcgatgccgtgaaagcatcacgtgtcttggttaac
caaccagattcagtcggaggtatcggtgatatctatacagacgcacttaaagccagctta
acaattggaacaggatcatgggggaaaaattcattgtcacacaatctttcaactggcgat
ctcttaaatatcaagactgttgcgaaacgtcgtaaccgtccacaatggattcgcttgcca
ggaaaaacttactacgaaaagaatgctatctcatatttgcaagatgaatatgaaccaatg
caacgtgctttgattatagcagacccaggtatggttcaatttggatttgttgacactgtc
cttgctcaattggcattgcgtgatgaaaaagtcgcaacatcaatttacgaaacaatcaaa
ccagacccaacccttggacaaacaatcgaaattgcaaaacaaatgcgtgatttcaaacca
gatacagtcattgcaattggtggtggctctgctattgatgcatctaagattgcacgttta
atttatgaattttatcttgaccgtggtgatgaattccttgatagttatgatgctgttagc
gaatttttccttgaattgcaacaaaaaatcatttatattcgtaaacgtattgtgaaattc
aaacatcaaacaacaatacgtctcttctgtatcccaaccacatctggtacaggtgctgag
gtgacaccatttgcggttattactgatgattatacacacgtgaaatacccacttgctgat
tatgaattggtaccacaagttgctattgttgatccagaatttgttatgactgtgccaaaa
cgtacagcagcttggtcaggattagatgctttgtcacatgctcttgaatcttacgtatca
gttatggcatctgactttacacgtccatggtctcttgaagctatcaagttgattattgaa
aatcttgaagatgcttataactacgatcctaagaacccaacacttcgtggtgaaaaagct
aaagaaaatatgcattatgcagcagttattgctggtatggcatttggtaatgctttctta
ggtatcaaccattcacttgctcacaaaacaggtggtgaatttggacttccacacggttta
gctatttcaatcgcaatgcaacatgttatccgctataacggtgcatctggtaatgttaaa
cgctcagtttatccacgttatgaagaataccgtgctcaaaaagattacgcagatattgcg
cattatattggtcttaaaggtaaagatgatgcagaattagtcgaagcactttgcgaccgc
attgataaattgattcatactgttgacgttgaaccaaaactttctgctaatgggatcaca
aaagaagcctttgatgcagcagctaatcgtttggcaagcttggcatatgatgaccaatgt
actccaataaacccacgtcaaccatacatttcagaattgaaacaacttttgattgatatg
ttctaa

DBGET integrated database retrieval system